KEGG   Actinosynnema mirum: Amir_5701Help
Entry
Amir_5701         CDS       T00957                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ami  Actinosynnema mirum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amir_5701
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amir_5701
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amir_5701
Enzymes [BR:ami01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amir_5701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(6731083..6732318)
Genome map
AA seq 411 aa AA seqDB search
MTRDQFAHTPHDPDERGHFGRWGGRFMPEALIAAQDELAAEYEKARVDPEFLGEFARLLK
EYAGRPSLLTEARRFAEHAGGARVFLKREDLNHTGSHKINNVLGQVLLTKRMGKKRVIAE
TGAGQHGVATATACALMGLDCVIYMGEVDTERQALNVARMRLLGAEVIPVGTGSRTLKDA
INEGLRDWVASVDHTHYLMGTAAGAHPFPMMVRDFHRVIGIEARQQVLDQAGRLPDAVAA
CVGGGSNAIGIFHGFIDDPSVRLVGLEPGGDGVETKRHGATLTKGTAGSLHGAMSYVLQT
EDGQIAEAHSISAGLDYPGVGPEHAHLKDTGRAEYRPITDAQAMDAFALLSRTEGIIPAV
ESAHALAGALDLGRELGPDGLIVVSLSGRGDKDMDTAVSWFGLGVKEEDAS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgaccagttcgcccacaccccccacgaccccgacgagcggggtcacttcggg
cggtggggtggccggttcatgccggaggcgctgatcgcggctcaggacgagttggccgcg
gagtatgagaaggcgcgggtcgacccggagttcctgggtgagttcgcccggctgctcaag
gagtacgcgggccgcccgtcgctgctgaccgaggccaggcggttcgccgagcacgcgggc
ggcgcgcgggtgttcctcaagcgcgaggacctcaaccacaccggctcgcacaagatcaac
aacgtgctgggccaggtgctgctcaccaagcgcatgggcaagaagcgcgtcatcgccgag
acgggcgcgggccagcacggcgtcgccaccgccacggcgtgcgcgctcatgggcctggac
tgcgtgatctacatgggcgaggtcgacaccgagcgccaggcgctcaacgtcgcccggatg
cggctcctcggcgccgaggtcatcccggtcggcaccggctcgcgcaccctcaaggacgcg
atcaacgagggcctgcgtgactgggtcgccagcgtcgaccacacccactacctgatgggc
acggcggcgggcgcgcacccgttcccgatgatggtccgcgacttccaccgggtgatcggc
atcgaggcccggcagcaggtgctcgaccaggccgggcggctgcccgacgcggtcgcggcc
tgcgtcggcggcggctccaacgccatcggcatcttccacggcttcatcgacgacccgtcg
gtgcgcctggtgggcctggagcccggcggcgacggcgtcgagaccaagcggcacggcgcc
accctcaccaagggcaccgcgggctcgctgcacggggccatgtcgtacgtgctccagacc
gaggacgggcagatcgccgaggcgcattccatctcggcgggcctggactaccccggcgtc
gggcccgagcacgcgcacctcaaggacaccggtcgcgccgagtaccggccgatcaccgac
gcgcaggcgatggacgcgttcgcgctgctgtcgcgcaccgagggcatcatccccgccgtc
gagtccgcgcacgccctcgcgggcgcgctggacctcgggcgggagctggggccggacggc
ctgatcgtggtcagcctgtccggtcgcggcgacaaggacatggacacggcggtctcgtgg
ttcgggctcggcgtcaaggaggaggacgcgtcgtga

DBGET integrated database retrieval system