KEGG   Actinosynnema mirum: Amir_5702Help
Entry
Amir_5702         CDS       T00957                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ami  Actinosynnema mirum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ami01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ami00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6732330..6733145)
Genome map
AA seq 271 aa AA seqDB search
MRMTVLESIIEGVREDLAAREAALPFEVLRERAAKAAPPQDVMAVLRNPGVGVIAEVKRK
SPSKGALADIPEPADLAAAYEAGGARVISVLTEQRRFGGSLADFDAVRAAVRVPLLRKDF
IVSPYQVHEARLHGADLVLLIVAALEQNALVSLLDRVESLGMTALVEVHTAEEADRALEA
GASVIGVNARNLHTLEVDKEVFGRIAPGLPFETIKIAESGVTGPGDLMAYAGAGADAVLV
GESLVTSGDPKVAVNKLVTAGSHPACPRPSR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatgaccgttctcgagtcgatcatcgaaggcgttcgggaggacctcgccgcgcgc
gaggcggcgctgcccttcgaggtgctcagggagcgggcggcgaaagccgcgcccccccag
gacgtgatggcggtgctgcgcaaccccggtgtcggggtcatcgccgaggtgaagcgcaag
agcccgtccaagggcgcgctcgcggacatccccgagccggccgacctggcggcggcctac
gaggcgggtggcgcgcgggtgatcagcgtgctgaccgagcagcgccgcttcggcgggtcg
ctggcggacttcgacgcggtgcgcgcggcggtgcgggtgccgctgctgcgcaaggacttc
atcgtcagcccgtaccaggtgcacgaggcgcgcctgcacggcgccgacctggtgctgctg
atcgtggcggcgctggagcagaacgcgctggtgtcgctgctcgaccgggtcgagtccctc
gggatgacggcgctggtcgaggtgcacacggccgaggaggccgaccgggcgctggaggcg
ggggcgagcgtcatcggcgtgaacgcccgcaacctgcacaccctggaggtcgacaaggag
gtgttcggccggatcgcgccgggcctgcccttcgagacgatcaagatcgccgagtccggt
gtcaccggccccggcgacctgatggcctacgccggggcgggcgccgacgcggtgctcgtc
ggcgagagcctggtgacgagcggcgaccccaaggtcgcggtgaacaagctggtgaccgct
ggatcgcacccggcgtgcccccggcccagtcgttga

DBGET integrated database retrieval system