KEGG   Actinosynnema mirum: Amir_5890Help
Entry
Amir_5890         CDS       T00957                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ami  Actinosynnema mirum
Pathway
ami00900  Terpenoid backbone biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01130  Biosynthesis of antibiotics
Module
ami_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Amir_5890
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Amir_5890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: ACU39699
JGI: Amir_5890
UniProt: C6WES4
Position
complement(6933764..6934984)
Genome map
AA seq 406 aa AA seqDB search
MSTPRKVLVLGSTGSIGTQALDVISTRRDQFAVAGLSAGGADLAALAAQALDFGAPAVAV
ARPDSAEDFALAYDAEVARRGLAPADHRRPRLLTGPDAASDLVDAAPADVVLNGITGSIG
LAPTLRALASGATLALANKESLIAGGPLVLSAAKPGQLVPVDSEHSALAQCLRGGRADEV
DRLVLTASGGPFRGRKRAELADVTVQQAMAHPTWSMGNVITINSATLVNKGLELIEAHLL
FGVPYDRIDVVVHPQSVIHSMVTFTDGSTLAQASPPDMRLPIALGLSWPDRVPGAASACT
FKEPTAWTFEPLDDDTFPAVRLARRAGTAGGCLPAVYNAANEEALAAFFVGATSFLSVVD
TVERVLDEADGWAHDPADVAEVLEAERWARTRARELVATSVGSGRD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccacgcaaggtcctggttctcgggtccacggggtcgatcggcacccaggca
ctcgacgtgatctccaccaggcgcgaccagttcgccgtcgcggggctgtccgcgggcggc
gcggacctcgcggcgctggccgcgcaggccctggacttcggcgccccggccgtcgccgtg
gcccgccccgactcggccgaggacttcgccctcgcctacgacgccgaggtcgcccgccgc
ggcctcgcgcccgccgaccaccgcaggccccggctgctgaccggaccggacgccgcgagc
gacctggtcgacgcggcccccgccgacgtggtgctcaacggcatcaccggctccatcggc
ctcgcccccaccctccgcgcgctcgcgtccggggccaccctcgcgctcgcgaacaaggag
tccctcatcgcgggcggcccgctggtgctctccgccgcgaagccgggccagctcgtcccg
gtcgactccgagcactccgcgctcgcccagtgcctgcgcggcggtcgcgccgacgaggtc
gaccggctcgtgctcaccgcctccggcggcccgttccgggggcgcaagcgcgcggagctg
gccgacgtcaccgtccagcaggccatggcccacccgacctggtcgatgggcaacgtgatc
accatcaactcggccaccctggtcaacaagggcctggagctgatcgaggcgcacctgctg
ttcggcgtgccctacgaccggatcgacgtcgtcgtgcacccccagtcggtgatccactcc
atggtcaccttcaccgacggctccaccctcgcccaggccagcccgccggacatgcgcctg
cccatcgcgctcggcctgtcctggcccgaccgcgttcccggcgcggcctccgcgtgtact
ttcaaagagccgaccgcgtggacgttcgagccgctggacgacgacacgttcccggcggtc
cggctcgccaggcgcgcgggcacggcgggcggttgcctgcccgccgtctacaacgcggcc
aacgaggaggcgctcgccgccttcttcgtgggcgcgacgtcgttcctctccgtggtcgac
accgtggagcgggtgctggacgaggcggacggctgggcacacgaccccgccgacgtcgcc
gaggtcctcgaagccgagcgctgggctcggacgagggctcgggaactggtggccacttcg
gtggggtctgggagggactga

DBGET integrated database retrieval system