KEGG   Actinosynnema mirum: Amir_5939Help
Entry
Amir_5939         CDS       T00957                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ami  Actinosynnema mirum
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ami00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6984682..6985563
Genome map
AA seq 293 aa AA seqDB search
MGIVLGPNQYGKAEVRLVSVTRDGDTHSIKDLTVSTSLRGDLVDTHLTGDNTKVLATDTQ
KNTAYAFAKLYGVHQVEDFALRLARHFVAGQAAITGARVLVDEHLWQRIETNGHSFTRSG
GEIRTAAVTVDHDRAWVVSGLKDLVVLKTTGSEFHGFPRDEFTTLAETDDRVLATSVTAR
WRHSSDEVVDWAASYAEVRRVLLSTFADKHSLSLQQTLYAMAEAVLLARPEVAEVRLSMP
NKHHVPVDLSPFGLDNRNEVFHAPQSPYGLIEGSALREEAEDAGLAWYSIGEF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgtcctggggccgaaccagtacggcaaggccgaggtccggctcgtgtccgtc
acccgtgacggtgacacccactcgataaaggacctcaccgtcagcacctcgctgcgcggc
gacctcgtcgacacccacctgaccggcgacaacaccaaggtcctcgccaccgacacccag
aagaacaccgcctacgccttcgccaagctctacggcgtccaccaggtcgaggacttcgcc
ctccggctcgcgcggcacttcgtggccggccaggcggcgatcaccggggcccgcgtgctc
gtcgacgagcacctctggcagcgcatcgagaccaacgggcactcgttcacccggtcgggc
ggggagatcaggaccgccgccgtgaccgtcgaccacgaccgggcctgggtggtgtccggg
ctcaaggacctcgtggtgctcaagaccaccggctcggagttccacgggttcccgcgcgac
gagttcaccaccctcgccgagaccgacgaccgggtgctcgccacctcggtcaccgcgcgc
tggcgccactcctcggacgaggtcgtcgactgggccgcgagctacgcggaggtccgccgc
gtgctgctgtcgacgttcgccgacaagcacagcctctcgctccagcagaccctctacgcc
atggcggaggccgtcctgctggcccgccccgaggtcgccgaggtgcggctgtcgatgccg
aacaagcaccacgtcccggtggacctgtccccgttcggtctggacaaccgcaacgaggtg
ttccacgcgccccagagcccgtacgggctgatcgagggctcggcgctgcgcgaggaggcc
gaggacgcggggctggcgtggtactcgatcggggagttctag

DBGET integrated database retrieval system