KEGG   Actinosynnema mirum: Amir_5939Help
Entry
Amir_5939         CDS       T00957                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ami  Actinosynnema mirum
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Amir_5939
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Amir_5939
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Amir_5939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6984682..6985563
Genome map
AA seq 293 aa AA seqDB search
MGIVLGPNQYGKAEVRLVSVTRDGDTHSIKDLTVSTSLRGDLVDTHLTGDNTKVLATDTQ
KNTAYAFAKLYGVHQVEDFALRLARHFVAGQAAITGARVLVDEHLWQRIETNGHSFTRSG
GEIRTAAVTVDHDRAWVVSGLKDLVVLKTTGSEFHGFPRDEFTTLAETDDRVLATSVTAR
WRHSSDEVVDWAASYAEVRRVLLSTFADKHSLSLQQTLYAMAEAVLLARPEVAEVRLSMP
NKHHVPVDLSPFGLDNRNEVFHAPQSPYGLIEGSALREEAEDAGLAWYSIGEF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgtcctggggccgaaccagtacggcaaggccgaggtccggctcgtgtccgtc
acccgtgacggtgacacccactcgataaaggacctcaccgtcagcacctcgctgcgcggc
gacctcgtcgacacccacctgaccggcgacaacaccaaggtcctcgccaccgacacccag
aagaacaccgcctacgccttcgccaagctctacggcgtccaccaggtcgaggacttcgcc
ctccggctcgcgcggcacttcgtggccggccaggcggcgatcaccggggcccgcgtgctc
gtcgacgagcacctctggcagcgcatcgagaccaacgggcactcgttcacccggtcgggc
ggggagatcaggaccgccgccgtgaccgtcgaccacgaccgggcctgggtggtgtccggg
ctcaaggacctcgtggtgctcaagaccaccggctcggagttccacgggttcccgcgcgac
gagttcaccaccctcgccgagaccgacgaccgggtgctcgccacctcggtcaccgcgcgc
tggcgccactcctcggacgaggtcgtcgactgggccgcgagctacgcggaggtccgccgc
gtgctgctgtcgacgttcgccgacaagcacagcctctcgctccagcagaccctctacgcc
atggcggaggccgtcctgctggcccgccccgaggtcgccgaggtgcggctgtcgatgccg
aacaagcaccacgtcccggtggacctgtccccgttcggtctggacaaccgcaacgaggtg
ttccacgcgccccagagcccgtacgggctgatcgagggctcggcgctgcgcgaggaggcc
gaggacgcggggctggcgtggtactcgatcggggagttctag

DBGET integrated database retrieval system