KEGG   Actinosynnema mirum: Amir_5942Help
Entry
Amir_5942         CDS       T00957                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ami  Actinosynnema mirum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_5942
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Amir_5942
   00630 Glyoxylate and dicarboxylate metabolism
    Amir_5942
Enzymes [BR:ami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Amir_5942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6987347..6988888)
Genome map
AA seq 513 aa AA seqDB search
MTGIRVLGGAVERGEQVLTPDALEFVAKLHRSFAATRDELIARRADRGPLGFLAETADVR
EGEWQVAPAPEPLRDRRVEITGPTERKMAINALNSGAKVWLADLEDANTPHWRNVVSGQV
NLYDAARGDISHTSPEGKRYELAEGPRPAIVVRPRGWHLPERGIEVEGRPAIGALVDFGL
HFFHNGALGRPYYYLPKLESYLEARLWNDVFTFAQAELGIAQGTIRATVLIETIPAAFQM
EEILHELREHASGLNAGRWDYLFSVIKYFRDAGREAVLPDRNAITMTAPFMRAYTELLVR
TCHKRGAFAIGGMAAFIPNRRDPEVTGRALAKVREDKTREAGDGFDGSWVAHPDLVPVCR
EVFDARLGTRPNQLDVTRNEVSVTASQLLDFASAGGSATAAGLRSAVDVGVRYLLSWLGG
NGAAAIHDLMEDAATAEISRSQLWQWVHNGVVLEDGTPVTAELVRGVLAEVRAELAGAGA
SEHLDVAVELFDRVALADDFVDFLTLPAYRHIA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaatccgagttctcggtggcgcggtcgagcgcggcgagcaggtcctgaccccg
gacgcgctggagttcgtggccaagctgcaccgctccttcgccgccacccgcgacgagctg
atcgcccgccgcgccgaccggggaccgctcgggttcctcgccgagaccgccgacgtgcgc
gagggcgagtggcaggtcgcccccgcccccgaaccgctgcgcgaccgccgggtcgagatc
accgggcccaccgagcgcaagatggcgatcaacgccctcaactccggcgcgaaggtgtgg
ctcgccgacctggaggacgccaacacgccgcactggcgcaacgtggtgtccgggcaggtc
aacctgtacgacgcggcgcgcggggacatctcgcacacctcgcccgagggcaagcggtac
gagctggccgagggcccgcgcccggcgatcgtggtgcgcccgcgcggctggcacctgccc
gagcgcggcatcgaggtcgagggcaggcccgccatcggcgcgctggtcgacttcgggctg
cacttcttccacaacggcgccctcggcaggccgtactactacctgccgaagctggagagc
tacctggaagcccggctgtggaacgacgtcttcacgttcgcccaggccgagctgggcatc
gcgcagggcacgatccgggcgaccgtcctcatcgagacgatcccggccgcgttccagatg
gaggagatcctgcacgagctgcgcgagcacgcctccgggctcaacgcgggccggtgggac
tacctgttcagcgtcatcaagtacttccgcgacgccgggcgcgaggccgtgctgcccgac
cgcaacgccatcaccatgaccgcgccgttcatgcgcgcctacaccgagctgctggtgcgg
acctgccacaagcgcggggcgttcgcgatcggcggcatggcggcgttcatcccgaaccgg
cgcgaccccgaggtgaccgggcgggcgctggcgaaggtgcgcgaggacaagacccgcgag
gccggtgacgggttcgacgggtcgtgggtggcgcacccggacctggtgccggtgtgccgc
gaggtgttcgacgcgcggctcgggacgaggccgaaccagctggacgtgacgcggaacgag
gtgtcggtgaccgcctcgcagctgctggacttcgcgtccgcgggcgggtcggcgaccgcc
gccgggctgcggtccgccgtggacgtcggggtgcggtacctgctgtcgtggctcggcggc
aacggggcggcggcgatccacgacctgatggaggacgcggccacggccgagatctcgcgg
tcgcagctgtggcagtgggtgcacaacggggtggtgctggaggacgggacgccggtgacg
gccgagctggtgcgcggggtgctggccgaggtgcgcgcggagctggccggggccggggcg
tccgagcacctggacgtggcggtggagctgttcgaccgggtcgcgctcgccgacgacttc
gtcgacttcctgaccctgcccgcctaccggcacatcgcctga

DBGET integrated database retrieval system