KEGG   Actinosynnema mirum: Amir_6057Help
Entry
Amir_6057         CDS       T00957                                 

Definition
glycoside hydrolase family protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ami  Actinosynnema mirum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Amir_6057
Enzymes [BR:ami01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Amir_6057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7109375..7110874
Genome map
AA seq 499 aa AA seqDB search
MTGAEGTFCLVLHSHLPWLAHHGAWPVGEEWLYQAWAHSYLPVVDLLERFAAEGRRDVLT
LGVTPVLAAQLDDPYSLRGVHDWLGNWQLRAHGAAPRLPELAAREHRESAVALERFEGRW
RHGFSPLLRPLVDSGVVELLGGPAAHPFQPLLDERLRAFALETGLRDTALRLGSRPAGIW
APECGYAPGMERGYAAAGVRRFLVDGPSLGNQTWAARRVGDSDVVCFGRDLEVSYRVWSP
RVGYPGHPDYRDFHTYDHASGLKPSRVTGVEVAPQDKRPYDPEAARAAVRGHTEDFVGAV
VARLRELRAAHGREALVVAAYDTELYGHWWHEGPLWLESVLRALPEAGVRVTTLRGAVEA
GHVVGSVEVPASSWGAGKDWNTWGGPQVADFVHANAELQRELLGLELGGAVRDPVADQAV
REALLSLSSDWAFMVTKDSAADYARYRAKAHAERFRELAVEIRAARGGSDLGRVDRARGR
AAELRALSGPFGHLDARAL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcgccgagggcacgttctgcctggtgctgcacagccacctgccgtggctcgcg
caccacggggcgtggccggtcggcgaggagtggctctaccaggcgtgggcgcactcgtac
ctgccggtggtggacctgctggagcggttcgccgccgagggcaggcgggacgtgctcacc
ctcggcgtcacgccggtgctggccgcgcagctggacgacccgtactcgctgcgcggcgtc
cacgactggctgggcaactggcagctgcgcgcccacggggccgcgccgaggctgccggag
ctggcagcccgcgagcaccgcgagtccgcggtggcgctggagcggttcgagggccggtgg
cggcacgggttctccccgctgctgcgccccctggtcgactcgggcgtggtggagctgctc
ggcggaccggccgcgcacccgttccagccgctgctcgacgagcggctgagggcgttcgcg
ctggagaccgggctgcgggacaccgcgctgcggctcggctcgcgaccagcggggatctgg
gccccggagtgcgggtacgcgccgggcatggagcgcgggtacgcggcggcgggcgtgcgg
cggttcctggtggacgggccgtcgctcgggaaccagacgtgggcggccaggcgggtcggc
gactcggacgtggtgtgcttcgggcgggacctggaggtgtcgtaccgggtgtggtcgccg
agggtcggctaccccggccaccccgactaccgggacttccacacctacgaccacgccagc
gggctcaagccgtcgcgggtgaccggggtcgaggtggccccgcaggacaagcggccgtac
gacccggaggccgcgcgggccgcggtgcgggggcacaccgaggacttcgtgggcgcggtc
gtggcgcggctgcgggagctgagggcggcgcacgggcgcgaggcgctggtggtcgccgcg
tacgacaccgagctgtacgggcactggtggcacgaggggccgctgtggctggagtcggtg
ctgcgcgcgctgcccgaggcgggggtgcgggtgacgacgctgcgcggcgcggtcgaggcc
gggcacgtggtggggtcggtggaggtcccggcgtcgtcgtggggcgcgggcaaggactgg
aacacctggggcgggccgcaggtggcggacttcgtgcacgcgaacgccgagctgcagcgg
gagctgctggggctggagctgggcggggcggtgcgggacccggtcgcggaccaggcggtg
cgggaggcgctgctgtcgctgtcgagcgactgggcgttcatggtgaccaaggacagcgcg
gcggactacgcgcggtaccgggcgaaggcgcacgcggagcggttccgggagctggcggtc
gagattcgggcggcgcgcgggggttcggacctcgggcgggtcgaccgggcgcgggggcgg
gcggcggagctgcgggcgctgtccgggccgttcgggcacctggacgcgagggcgctgtga

DBGET integrated database retrieval system