KEGG   Actinosynnema mirum: Amir_6181Help
Entry
Amir_6181         CDS       T00957                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ami  Actinosynnema mirum
Pathway
ami00052  Galactose metabolism
ami00561  Glycerolipid metabolism
ami00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Amir_6181
  Lipid metabolism
   00561 Glycerolipid metabolism
    Amir_6181
   00600 Sphingolipid metabolism
    Amir_6181
Enzymes [BR:ami01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Amir_6181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C
Motif
Other DBs
NCBI-ProteinID: ACU39988
JGI: Amir_6181
UniProt: C6WHN9
Position
7245381..7247504
Genome map
AA seq 707 aa AA seqDB search
MADLRHLRAAGVSLVLDLTGGTLPRVLHWGADLGPDPDLESLRLLSLRQPIGNSVDGHVE
VSVLPEQSAGWLGTPGLVGHREGADFSVALRVTGVEGSGDGVVVRAVDETAGLGAEVLVE
LLPSGVVRQRARVTNTGDSVFTVDALNLALPVPAEAVELLDFSGHHLRERAPQRTRFTQG
LRVRENRTGRTGYDTAYVLAAGTEGFANRRGEVWAVHTAWSGNHRTFAERTFHAVSLLGS
GELLLAGEGRLAPGAVYESPWQYGSYGAAGLDSVSARFHGFLRSRPGHPTSPRPVVVNTW
EAVYFDHDLDRLKALADAAAEVGAERFVLDDGWFGSRRDDKRGLGDWYVSDEVWPDGLGP
IVSHVTGLGLQFGLWVEPEMINEDSELARAHPDWIMATGGRLPRAARQQQVLDLTKAYDY
ILERLDSLLSEYDIAYLKWDHNRDLVEAGHQPGGQAGVRAQTLAVYRLLDELRARHPGVE
IESCSSGGGRIDLEILQRTDRVWTSDCIDALERQRIQRWTNLLIPLELMGSHVGDGRSHT
TDRLHKLDFRAGTALFGHFGIESDLTRVSAEDRARLTEWVGLYKSLRGLLHTGVSVHGDH
PDPAIEVHGVVAGDGSDAVYAVVAHGTSEIYPTGAVRLPGLAADREYHVRPLAPGDVPDG
NAHHWGNPLPWWTPEGVRVGGRALEVMGVQAPVLYPERLVLIRATAV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
gtggcggacctgaggcacctgcgcgccgcgggcgtgagcctggtgctcgacctgaccgga
gggaccctcccccgcgtgctgcactggggcgcggacctggggcccgaccccgacctggag
tcgctgcggctgctgtcgctgcgccagcccatcggcaactcggtggacgggcacgtggag
gtgtccgtgctgcccgagcagtcggcgggctggctcggcacccccggcctcgtcgggcac
cgggagggcgcggacttctcggtggcgctccgggtgaccggggtggagggctccggggac
ggcgtggtcgtgcgcgccgtcgacgagaccgccgggctgggcgcggaggtgctcgtcgaa
ctgctgccgtccggcgtggtgcggcagcgcgcgcgggtgacgaacaccggcgactcggtg
ttcaccgtggacgcgctgaacctggcgctgccggtgcccgccgaggcggtggagctgctc
gacttcagcggccaccacctgcgcgagcgggccccgcagcggacccggttcacccagggc
ctgcgggtgcgggagaaccggaccgggcgcaccggctacgacacggcgtacgtgctggcg
gcgggcaccgagggcttcgcgaaccggcgcggcgaggtgtgggcggtgcacacggcctgg
tcgggcaaccaccggacgttcgccgagcgcacgttccacgcggtgtccctgctcgggtcc
ggcgagctgctgctcgcgggcgaggggcggctggcgccgggtgcggtgtacgagtcgccg
tggcagtacggctcgtacggcgcggccgggctggactcggtgtcggcgcggttccacggg
ttcctgcgctcgcgccccggccacccgacctcgccccggccggtcgtggtgaacacgtgg
gaggcggtgtacttcgaccacgacctggaccggctgaaggcgctggcggacgcggcggcg
gaggtcggcgcggagcggttcgtgctggacgacggctggttcgggtcgcggcgcgacgac
aagcgcgggctcggcgactggtacgtgtcggacgaggtgtggccggacgggctcgggccg
atcgtctcgcacgtgaccgggctggggttgcagttcgggctgtgggtcgagccggagatg
atcaacgaggactccgagctggcgcgggcccacccggactggatcatggccaccggcggg
cggttgccgcgcgcggcgcgccagcagcaggtgctggacctgaccaaggcgtacgactac
atcctggagcggttggactcgctgctgagcgagtacgacatcgcgtacctcaagtgggac
cacaaccgggacctcgtggaggccgggcaccagcctggcggtcaagccggggtgcgggcg
cagacgctggccgtgtaccggctgctggacgagctgcgggcgcggcaccccggggtggag
atcgagtcgtgctcgtcgggcggcgggcggatcgacctggagatcctgcagcgcacggac
cgggtgtggacgtcggactgcatcgacgcgctggagcggcagcgcatccagcggtggacg
aacctgctgatcccgctggagctgatgggctcgcacgtgggtgacgggcgctcgcacacg
acggaccggctgcacaagctggacttccgggcggggacggcgctgttcgggcacttcggg
atcgagtcggacctgacgcgggtgtcggcggaggaccgggcgcggttgacggagtgggtg
gggctgtacaagtcgctgcgggggctgctgcacaccggggtgtcggtgcacggggaccac
ccggacccggcgatcgaggtgcacggggtcgtggcgggcgatgggtcggacgcggtgtac
gcggtggtggcgcacgggacgtcggagatctacccgacgggggcggtgcggttgccgggg
ttggcggcggaccgggagtaccacgtgcggccgttggcgccgggggacgtgccggacggg
aacgcgcaccactgggggaaccccctgccttggtggaccccggagggggttcgggttggg
gggcgggcgctggaggtcatgggggtgcaggctccggtgctctatccggagcggttggtg
ttgatccgggccacggcggtgtga

DBGET integrated database retrieval system