KEGG   Actinosynnema mirum: Amir_6207Help
Entry
Amir_6207         CDS       T00957                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ami  Actinosynnema mirum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ami00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Amir_6207
Enzymes [BR:ami01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Amir_6207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7273237..7275414)
Genome map
AA seq 725 aa AA seqDB search
MAEGAVLEAVLERITFANEETGYTVARVDTGRGADLITVVGALLGAQPGESIRMRGRWGS
HPQYGKQFHVDDYTTVLPATIQGIRRYLGSGLIKGIGPVLADRIVTHFGVDALDVIEQHP
ERLVEVPKLGPKRTKMIAAAWEEQKAIKEVMVFLQGVGVSTSLAVRIYKQYADRSIDVVR
EEPYRLATDVWGIGFRTADVIAKAVGIPHDSPQRIKAGLQFTLSEATGGGNCFLPENELI
GDAIRILQVDAGLVIDCLAELVDEEGVVREIQPDGEAAVYLIPFHRAEISLATQLRRLLA
TDDDRLPAFASVDWTKALRWLGAELEGKQEAAVRLALTNKVAVLTGGPGCGKSFTVRSIV
RLALAKGAKVVLAAPTGRAAKRLAELTGHAASTVHRLLELKPGGDAAYDRDRPLDADLVV
VDEASMLDLLLANKLVKAVPPGAHLLLVGDVDQLPSVGAGEVLRDVLATGSPVPNVRLTH
VFRQAQQSGVVTNAHRINAGEPPVVQGLADFFLFPVEDAEEAAEVTVDVVARRIPRKFGL
DPRKDVQVLAPMHRGAAGAGGLNAVLQEALTPAREGLPERRFGGRVFRVGDKVTQIRNNY
DKGANGVFNGTLGVVTGIDSVEQRVTVRTDEDEDVDYEFGELDELTHAYAMTIHRSQGSE
YPCVVIPITTSAWMMLQRNLLYTAVTRAKKLVVLVGSRKAIGQAVRTVGAGRRHTALDHR
LTGTL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagggtgctgtgctggaagccgtgctcgagcggatcaccttcgcgaacgaggag
accgggtacacggtcgcccgcgtcgacaccgggcgtggcgcggatctgatcaccgtcgtc
ggggccctcctcggcgcgcagcccggtgagtccatccggatgcgcgggcgctggggttcg
cacccgcagtacggcaagcagttccacgtcgacgactacaccaccgtcctccccgccacc
atccagggcatccgccgctacctcggttccggcctgatcaagggcatcggccccgtgctc
gccgaccggatcgtcacgcacttcggggtcgacgcgctcgacgtcatcgagcagcacccc
gagcgcctcgtcgaggtgcccaagctcgggcccaagcgcacgaagatgatcgccgccgcg
tgggaggagcagaaggccatcaaggaggtcatggtcttcctccagggggtcggggtctcg
acctccctcgcggtgcgcatctacaagcagtacgccgaccgctcgatcgacgtggtccgc
gaagagccctaccggctcgccaccgacgtgtggggcatcgggttccgcaccgccgacgtc
atcgccaaggccgtcggcatcccccacgacagcccccagcgcatcaaggccggcctccag
ttcacgctctccgaggccaccggcggcggcaactgcttcctgcccgagaacgagctcatc
ggcgacgccatccgcatcctccaggtcgacgcgggcctggtcatcgactgcctcgccgag
ctcgtcgacgaggagggggtggtccgcgagatccagccggacggcgaggccgccgtctac
ctgatccccttccaccgcgccgagatctcactggccacccagctgcgccgactcctcgcc
accgacgacgaccggctgcccgcgttcgcctccgtggactggaccaaggccctccgctgg
ctcggcgccgagctggagggcaagcaggaggccgccgtgcgcctcgcgctcaccaacaag
gtcgccgtgctcaccggtggacccggctgcggcaagagcttcaccgtgcgctcgatcgtc
cgcctcgccctggccaagggcgcgaaggtcgtgctcgccgccccgacgggacgcgccgcg
aagcggctggccgagctgaccggccacgcggcgtccaccgtgcaccgcctgctggagctc
aagcccggcggtgacgccgcctacgaccgcgaccggccgctcgacgcggacctggtcgtc
gtggacgaggcgtccatgctggacctgctgctcgccaacaagctcgtcaaggccgtccct
cccggcgcgcacctgctgctggtcggcgacgtcgaccagctgccctcggtgggcgcgggc
gaggtgctgcgggacgtgctggccaccggcagcccggtgccgaacgtgcgcctcacgcac
gtgttccgccaggcccagcagtccggcgtggtcaccaacgcgcaccgcatcaacgcgggc
gaacccccggtggtgcaggggctggcggacttcttcctgttcccggtcgaggacgccgag
gaggcggccgaggtgaccgtggacgtggtcgcgcgccgcatcccgcgcaagttcggcctc
gacccgcgcaaggacgtgcaggtcctcgcgcccatgcaccggggcgcggcgggcgcgggc
gggctcaacgccgtgctgcaggaggcgctgacccccgcgcgcgagggcctgccggagcgc
aggttcggcgggcgggtgttccgggtcggggacaaggtcacccagatccgcaacaactac
gacaagggcgcgaacggggtcttcaacggcacgctcggggtggtcaccgggatcgactcg
gtggagcagagggtgacggtccggaccgatgaggacgaggacgtggattatgagttcggc
gagctggacgagttgacccacgcctacgccatgacgattcaccgttcacagggcagtgag
tacccgtgcgtggtcatcccaatcaccacgagtgcctggatgatgctccagcggaacctg
ctctacacggcggtgacccgcgcgaagaagctcgtggtgctggtcggctcgcgcaaggcg
atcgggcaggcggtgcgcacggtgggcgccgggcgccgccacaccgcgctcgaccaccgg
ctcaccggcacgctctga

DBGET integrated database retrieval system