KEGG   Actinosynnema mirum: Amir_6245Help
Entry
Amir_6245         CDS       T00957                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ami  Actinosynnema mirum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Amir_6245
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Amir_6245
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Amir_6245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7324109..7324600
Genome map
AA seq 163 aa AA seqDB search
MSIHDIAVNTLTGEPSSLGSLRGKALLVVNVASKCGLTPQYSALERLHAKYAPQGFSVVG
FPCNQFGGQEPGTAEEIATFCSATYGVTFPMFEKVEVNGANRHPVYEALVESADADGAAG
DVQWNFEKFLLSPDGEVLARFRPRTEPEDEAVVRAVEAALPNA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccacgacatcgcggtgaacaccctgaccggcgagccgagcagcctcggttcg
ctgcggggcaaggcgctgctggtggtcaacgtcgcctccaagtgcgggctgaccccgcag
tactcggcgctggagcggctgcacgcgaagtacgccccgcagggcttctccgtggtgggc
ttcccgtgcaaccagttcggcggccaggagccgggcacggcggaggagatcgccacgttc
tgctcggcgacgtacggcgtgacgttcccgatgttcgagaaggtcgaggtcaacggcgcg
aaccggcacccggtgtacgaggccctcgtggagagcgcggacgccgacggcgcggcgggc
gacgtgcagtggaacttcgagaagttcctgctgtcccccgacggcgaggtcctggcgcgc
ttccgcccgaggaccgaaccggaggacgaggcggtcgtgcgcgcggtcgaggccgctctg
ccgaacgcctga

DBGET integrated database retrieval system