KEGG   Actinosynnema mirum: Amir_6334Help
Entry
Amir_6334         CDS       T00957                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
ami  Actinosynnema mirum
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Amir_6334
Enzymes [BR:ami01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Amir_6334
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Amir_6334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7426558..7427943
Genome map
AA seq 461 aa AA seqDB search
MTERGAAGAAAEPSAAEPPGADHAASGGVTILPVPGLPEFRPGDDLAGALATAAPWLADG
DVVVVTSKVVSKVEGRLVRVPADPEERDAVRRHWVRAEAVSVIARRNRTLITENKLGIIQ
AASGVDASNVAGDEIALLPVDPDASAAALRARLAELLGVEVAVVVTDTMGRAWRVGQTDA
AIGAAGLAVLHRYAGSVDRQGNSLVVTEVAVADEIAAAADLVKGKLGAVPVAVVRGLPTS
DDGSKARDLARPVEDDLFRMGTAEAIAKGRAEALLVRRSVRAFTAEPVDRDLLRRAVGAA
LTAPAPHHTRPVRFVHVRERRTALLEAMRERWREDLRADGLSEEEVARRTARGDFLRDAP
EIVLPFLVRSGAHAYPDERRAEAERTMFTIAGGAAVQGLLVALAAEGVGSCWVSSTIFCP
DVVRAALDLPSSWEPLGAVAVGHPVEPLEARPLVEEGFVEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
ttgactgagcgcggagccgctggggcggctgcggagccctcggctgcggagccccccggc
gcggaccacgcggcctccgggggcgtcacgatcctgccggtgcccggcctgccggagttc
cggccgggcgacgacctggcgggcgcgctcgcgaccgccgcgccgtggctggccgacggc
gacgtggtcgtggtgaccagcaaggtcgtctcgaaggtcgagggcaggctggtgcgggtg
cccgccgacccggaggagcgggacgcggtgcgcaggcactgggtgcgcgccgaggcggtg
tcggtgatcgcgcggaggaaccgcacgctgatcaccgagaacaagctgggcatcatccag
gcggcctccggcgtggacgcctcgaacgtggcgggcgacgagatcgcgctgctcccggtg
gacccggacgcgtcggccgccgcgctgcgggcgaggctggcggagctgctgggcgtggag
gtggccgtggtggtcaccgacacgatgggccgggcctggcgggtcgggcagaccgacgcg
gcgatcggcgcggcgggcctggcggtgctgcaccggtacgcgggctcggtggaccggcag
ggcaactccctggtggtgaccgaggtggcggtggccgacgagatcgccgcggcggccgac
ctggtcaagggcaagctgggcgcggtcccggtggccgtggtgcgcggcctgccgacctcg
gacgacggctcgaaggcccgcgacctggcccgcccggtcgaggacgacctgttccggatg
ggcacggcggaggcgatcgcgaagggccgcgccgaggcgctgctggtgcgccgctcagtg
cgggcgttcacggccgagccggtggaccgggacctgctgcgcagggcggtgggagcggca
ctgaccgcaccggcgccgcaccacaccaggccggtccggttcgtgcacgtgcgggagcgc
aggacggcgctgctggaggccatgcgggagcgctggcgcgaggacctgcgcgccgacggc
ctgtccgaggaggaggtggccaggcgcaccgcgcgcggcgacttcctgcgcgacgccccg
gagatcgtgctgcccttcctggtcaggtcgggcgcccacgcctacccggacgagcgcagg
gccgaggccgagcgcaccatgttcacgatcgcgggtggcgccgccgtgcagggcctgctg
gtggcgctggccgccgagggcgtcggctcgtgctgggtgtcgtcgacgatcttctgcccg
gacgtggtccgcgcggcgctggacctgccgtcgtcgtgggaaccgctgggcgcggtggcg
gtgggccacccggtggaaccgctggaggccaggccgctcgtggaggaagggttcgtggag
ctgtga

DBGET integrated database retrieval system