KEGG   Actinosynnema mirum: Amir_6409Help
Entry
Amir_6409         CDS       T00957                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ami  Actinosynnema mirum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Amir_6409
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Amir_6409
Exosome [BR:ami04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Amir_6409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7502977..7504491)
Genome map
AA seq 504 aa AA seqDB search
MTKYVAAIDQGTTSTRCMVFDHSGRVVAVDQKEHEQIFPKAGWVEHDAEEIWLNTRQVAA
GALARADLNASDLAAVGITNQRETALVWDRTTGKPVYNAIVWQDTRTDRICAELGALGGG
QERYRAKTGLPLATYFSGPKVKWVLDNVEGARERAEAGDLLFGNMDTWVLWNLTGGVHGG
LHVTDPTNASRTLLMDLDTLDWDAEIAADMGIPLSMLPEIRSSSEVYSEVKTRGALEGVP
IAGVLGDQQAATFGQACLSPGEAKNTYGTGNFLLLNTGTEKVMSENGLLTTVCYKIGDKA
PVYALEGSIAVTGSLVQWLRDNLGMIGTAAEIEQYARTVEDNGGAYFVPAFSGLFAPYWR
SDARGAIVGLTRFVNKGHLARAVLEATAYQSREVIDAMNADSGVPLKSLKVDGGMVVNEL
LMQFQADILGVPVIRPVVNETTALGAAYAAGLAVGFWASEDDIRQNWAQDKQWDPAMDDS
VREKRYRSWKKAVTKTFDWVEDED
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagtacgtcgccgccatcgaccagggcacgacctccacccggtgcatggtcttc
gaccactccgggcgggtcgtcgcggtcgaccagaaggagcacgagcagatcttcccgaag
gcggggtgggtcgagcacgacgccgaggagatctggctgaacacacgccaggtcgcggcg
ggcgcgctggccagagcagacctgaacgcctccgacctggccgccgtcggcatcacgaac
cagcgcgagaccgcgctggtgtgggaccggaccaccggcaagccggtctacaacgcgatc
gtctggcaggacacccgcaccgaccgcatctgcgccgagctgggcgcgctgggcggcggg
caggagcggtaccgggccaagacgggcctgccgctggccacgtacttctccgggcccaag
gtcaagtgggtgctcgacaacgtcgagggcgcgcgggagcgggccgaggccggggacctg
ctgttcggcaacatggacacctgggtgctgtggaacctgaccggcggggtgcacggcggc
ctgcacgtcacggacccgaccaacgcgtcccgcacgctgctgatggacctggacaccctg
gactgggacgcggagatcgcggccgacatgggcatcccgctgtcgatgctgccggagatc
cggtcgtcgtccgaggtgtacagcgaggtgaagacgaggggcgcgctggagggcgtgccg
atcgcgggcgtgctcggtgaccagcaggcggcgacgttcgggcaggcctgcctctcgccg
ggcgaggccaagaacacgtacggcaccggcaacttcctgctgctcaacacgggcaccgag
aaggtgatgagcgagaacgggctgctcaccaccgtgtgctacaagatcggcgacaaggcc
ccggtgtacgcgctggaggggtcgatcgcggtcaccgggtcgctggtgcagtggctgcgg
gacaacctggggatgatcgggaccgcggcggagatcgagcagtacgcgcggacggtcgag
gacaacggcggggcgtacttcgtcccggcgttctcggggctgttcgcgccgtactggcgg
tcggacgcgcgcggggcgatcgtcgggctgacccggttcgtgaacaaggggcacctggcg
cgggcggtgctggaggccacggcgtaccagtcgcgcgaggtcatcgacgcgatgaacgcg
gattccggggtgccgctgaagtcgctgaaggtggacggcgggatggtcgtcaacgagctg
ctgatgcagttccaggcggacatcctcggggttccggtgatccggccggtggtgaacgag
accacggcgctgggcgcggcctacgcggcggggttggcggtcgggttctgggcgtcggag
gacgacatccggcagaactgggcgcaggacaagcagtgggaccccgcgatggacgactcg
gtgcgggagaagcggtaccggagctggaagaaggccgtgacgaagaccttcgactgggtc
gaggacgaggactga

DBGET integrated database retrieval system