KEGG   Actinosynnema mirum: Amir_6419Help
Entry
Amir_6419         CDS       T00957                                 

Definition
(GenBank) Methylmalonyl-CoA mutase
  KO
K01847  methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
ami  Actinosynnema mirum
Pathway
ami00280  Valine, leucine and isoleucine degradation
ami00630  Glyoxylate and dicarboxylate metabolism
ami00640  Propanoate metabolism
ami01100  Metabolic pathways
ami01120  Microbial metabolism in diverse environments
ami01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Amir_6419
   00640 Propanoate metabolism
    Amir_6419
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Amir_6419
Enzymes [BR:ami01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Amir_6419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase
Motif
Other DBs
NCBI-ProteinID: ACU40220
JGI: Amir_6419
UniProt: C6WKG9
Position
complement(7515313..7517094)
Genome map
AA seq 593 aa AA seqDB search
MMEQPGELALAAEFPEPDRERWLGLVEGVLGKTGAEYDSLVTTTYDGIAVQPLHTADEPL
PATGLPGTFPFTRGGRPQGTALGWEIRQQHREADREAVMADLENGVGALWLRGIAAADLE
PLLAEVYLDLAPVVLDAGADFAASGRELLRIWGERSAPGSELAGNLGADPLGVLAATGQE
PDTAALLDLLPRLDPFPAARLIAVDALPHHGAGGSDAQELGASLAAGVAYLRLLTDAGLT
VARAARLLEFRYAATADQFLTTAKLRAARRLWARVTEVCGEPSPQVQHAVTSPAMMTRRD
PWVNMLRTTIACAGAGMGGADAITVLPFDHAIGLPDDFSRRIARNTQSVLLEESRLSAVI
DPAGGSWYVERLTEDLARAAWRWFQEIEAGGGLAAALRSGLVADRLAETWERRRANLADR
TDAITGVSEFPNLGEKPVVRRPAPPEPGGGLPVIRYAQDFEALRDRADAAPERPKVFLAT
LGPVAAHTARATFAANLLQAGGVETPQAGPTRTADDVVAAFRASGARVACLCGSESSYAE
LAAPVADALRAAGAERVLLAGKRSDATVDDHLFLGCPALDVLGRTFESLGVPR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcagccgggcgagctggcgctggccgccgagttccccgaacccgaccgcgag
cggtggctgggcctggtcgagggcgtgctcggcaagaccggcgccgagtacgactcgctc
gtcaccacgacctacgacggcatcgccgtgcagccgctgcacaccgccgacgagcccctg
cccgccaccggcctgcccggcacgttcccgttcaccaggggcggcaggccgcagggcacc
gcgctgggctgggagatccgccagcagcaccgggaggccgaccgcgaggcggtcatggcc
gacctggagaacggcgtcggcgcgctgtggctcaggggcatcgccgccgccgacctggaa
ccgctgctcgccgaggtctacctggacctcgccccggtggtgctcgacgcgggggccgac
ttcgccgcgtccggccgggagctgctgcggatctggggcgagcggtccgcgccgggcagc
gagctggcgggcaacctcggcgccgacccgctcggcgtcctcgccgccaccgggcaggag
cccgacaccgccgccctgctcgacctgctgccgcgcctggacccgttcccggccgccagg
ctgatcgccgtcgacgccctcccgcaccacggcgcgggcggctccgacgcgcaggagctc
ggcgcctcgctcgccgcgggcgtggcctacctgcggctgctcaccgacgccgggctcacc
gtcgcgcgcgccgctcggctgctggagttccgctacgcggccaccgccgaccagttcctc
accaccgccaagctccgcgccgcccgcaggctgtgggcccgcgtcaccgaggtgtgcggc
gagccgtccccgcaggtccagcacgccgtgacgtccccggcgatgatgacccgccgcgac
ccgtgggtgaacatgctgcgcaccacgatcgcctgcgcgggcgccgggatgggcggggcc
gacgcgatcaccgtgctgccgttcgaccacgccatcggcctgcccgacgacttctcccgc
cgcatcgcccgcaacacccagtcggtgctgctggaggagtcgcggctgtcggcggtgatc
gacccggcgggcggctcctggtacgtggagcggctcaccgaggacctcgcgcgggccgcg
tggcgctggttccaggagatcgaggccgggggcgggctcgccgccgcgctgcgctccggc
ctggtcgccgaccggctcgccgagacctgggagcgccgccgcgccaacctcgccgaccgc
accgacgccatcaccggcgtcagcgagttcccgaacctgggcgagaagcccgtcgtgcgc
cgcccagccccgccggaacccggcggcgggctgcccgtgatccggtacgcccaggacttc
gaggcgctgcgcgaccgcgccgacgccgcccccgagcggccgaaggtcttcctggccacg
ctcggaccggtcgccgcgcacaccgcccgcgcgaccttcgccgccaacctgctccaggcg
ggcggcgtcgagaccccgcaggccggtcccacgaggaccgccgacgacgtcgtcgcggcg
ttccgcgccagcggcgcccgcgtcgcctgcctgtgcggcagcgagagctcctacgcggag
ctggccgcccccgtcgccgacgccctgcgcgcggcgggcgccgagcgcgtcctgctcgcg
ggcaagcgctccgacgcgaccgtcgacgaccacctgttcctgggctgccccgcgctcgac
gtgctcgggcgcaccttcgagtccctcggagtcccacgatga

DBGET integrated database retrieval system