KEGG   Actinosynnema mirum: Amir_6419Help
Entry
Amir_6419         CDS       T00957                                 

Definition
methylmalonyl-CoA mutase (EC:5.4.99.2)
Orthology
K01847  
methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
ami  Actinosynnema mirum
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_6419
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Amir_6419
   00640 Propanoate metabolism
    Amir_6419
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Amir_6419
Enzymes [BR:ami01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Amir_6419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7515313..7517094)
Genome map
AA seq 593 aa AA seqDB search
MMEQPGELALAAEFPEPDRERWLGLVEGVLGKTGAEYDSLVTTTYDGIAVQPLHTADEPL
PATGLPGTFPFTRGGRPQGTALGWEIRQQHREADREAVMADLENGVGALWLRGIAAADLE
PLLAEVYLDLAPVVLDAGADFAASGRELLRIWGERSAPGSELAGNLGADPLGVLAATGQE
PDTAALLDLLPRLDPFPAARLIAVDALPHHGAGGSDAQELGASLAAGVAYLRLLTDAGLT
VARAARLLEFRYAATADQFLTTAKLRAARRLWARVTEVCGEPSPQVQHAVTSPAMMTRRD
PWVNMLRTTIACAGAGMGGADAITVLPFDHAIGLPDDFSRRIARNTQSVLLEESRLSAVI
DPAGGSWYVERLTEDLARAAWRWFQEIEAGGGLAAALRSGLVADRLAETWERRRANLADR
TDAITGVSEFPNLGEKPVVRRPAPPEPGGGLPVIRYAQDFEALRDRADAAPERPKVFLAT
LGPVAAHTARATFAANLLQAGGVETPQAGPTRTADDVVAAFRASGARVACLCGSESSYAE
LAAPVADALRAAGAERVLLAGKRSDATVDDHLFLGCPALDVLGRTFESLGVPR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcagccgggcgagctggcgctggccgccgagttccccgaacccgaccgcgag
cggtggctgggcctggtcgagggcgtgctcggcaagaccggcgccgagtacgactcgctc
gtcaccacgacctacgacggcatcgccgtgcagccgctgcacaccgccgacgagcccctg
cccgccaccggcctgcccggcacgttcccgttcaccaggggcggcaggccgcagggcacc
gcgctgggctgggagatccgccagcagcaccgggaggccgaccgcgaggcggtcatggcc
gacctggagaacggcgtcggcgcgctgtggctcaggggcatcgccgccgccgacctggaa
ccgctgctcgccgaggtctacctggacctcgccccggtggtgctcgacgcgggggccgac
ttcgccgcgtccggccgggagctgctgcggatctggggcgagcggtccgcgccgggcagc
gagctggcgggcaacctcggcgccgacccgctcggcgtcctcgccgccaccgggcaggag
cccgacaccgccgccctgctcgacctgctgccgcgcctggacccgttcccggccgccagg
ctgatcgccgtcgacgccctcccgcaccacggcgcgggcggctccgacgcgcaggagctc
ggcgcctcgctcgccgcgggcgtggcctacctgcggctgctcaccgacgccgggctcacc
gtcgcgcgcgccgctcggctgctggagttccgctacgcggccaccgccgaccagttcctc
accaccgccaagctccgcgccgcccgcaggctgtgggcccgcgtcaccgaggtgtgcggc
gagccgtccccgcaggtccagcacgccgtgacgtccccggcgatgatgacccgccgcgac
ccgtgggtgaacatgctgcgcaccacgatcgcctgcgcgggcgccgggatgggcggggcc
gacgcgatcaccgtgctgccgttcgaccacgccatcggcctgcccgacgacttctcccgc
cgcatcgcccgcaacacccagtcggtgctgctggaggagtcgcggctgtcggcggtgatc
gacccggcgggcggctcctggtacgtggagcggctcaccgaggacctcgcgcgggccgcg
tggcgctggttccaggagatcgaggccgggggcgggctcgccgccgcgctgcgctccggc
ctggtcgccgaccggctcgccgagacctgggagcgccgccgcgccaacctcgccgaccgc
accgacgccatcaccggcgtcagcgagttcccgaacctgggcgagaagcccgtcgtgcgc
cgcccagccccgccggaacccggcggcgggctgcccgtgatccggtacgcccaggacttc
gaggcgctgcgcgaccgcgccgacgccgcccccgagcggccgaaggtcttcctggccacg
ctcggaccggtcgccgcgcacaccgcccgcgcgaccttcgccgccaacctgctccaggcg
ggcggcgtcgagaccccgcaggccggtcccacgaggaccgccgacgacgtcgtcgcggcg
ttccgcgccagcggcgcccgcgtcgcctgcctgtgcggcagcgagagctcctacgcggag
ctggccgcccccgtcgccgacgccctgcgcgcggcgggcgccgagcgcgtcctgctcgcg
ggcaagcgctccgacgcgaccgtcgacgaccacctgttcctgggctgccccgcgctcgac
gtgctcgggcgcaccttcgagtccctcggagtcccacgatga

DBGET integrated database retrieval system