KEGG   Actinosynnema mirum: Amir_6419Help
Entry
Amir_6419         CDS       T00957                                 

Definition
methylmalonyl-CoA mutase (EC:5.4.99.2)
Orthology
K01847  
methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
ami  Actinosynnema mirum
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ami01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ami00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ami00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ami00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7515313..7517094)
Genome map
AA seq 593 aa AA seqDB search
MMEQPGELALAAEFPEPDRERWLGLVEGVLGKTGAEYDSLVTTTYDGIAVQPLHTADEPL
PATGLPGTFPFTRGGRPQGTALGWEIRQQHREADREAVMADLENGVGALWLRGIAAADLE
PLLAEVYLDLAPVVLDAGADFAASGRELLRIWGERSAPGSELAGNLGADPLGVLAATGQE
PDTAALLDLLPRLDPFPAARLIAVDALPHHGAGGSDAQELGASLAAGVAYLRLLTDAGLT
VARAARLLEFRYAATADQFLTTAKLRAARRLWARVTEVCGEPSPQVQHAVTSPAMMTRRD
PWVNMLRTTIACAGAGMGGADAITVLPFDHAIGLPDDFSRRIARNTQSVLLEESRLSAVI
DPAGGSWYVERLTEDLARAAWRWFQEIEAGGGLAAALRSGLVADRLAETWERRRANLADR
TDAITGVSEFPNLGEKPVVRRPAPPEPGGGLPVIRYAQDFEALRDRADAAPERPKVFLAT
LGPVAAHTARATFAANLLQAGGVETPQAGPTRTADDVVAAFRASGARVACLCGSESSYAE
LAAPVADALRAAGAERVLLAGKRSDATVDDHLFLGCPALDVLGRTFESLGVPR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcagccgggcgagctggcgctggccgccgagttccccgaacccgaccgcgag
cggtggctgggcctggtcgagggcgtgctcggcaagaccggcgccgagtacgactcgctc
gtcaccacgacctacgacggcatcgccgtgcagccgctgcacaccgccgacgagcccctg
cccgccaccggcctgcccggcacgttcccgttcaccaggggcggcaggccgcagggcacc
gcgctgggctgggagatccgccagcagcaccgggaggccgaccgcgaggcggtcatggcc
gacctggagaacggcgtcggcgcgctgtggctcaggggcatcgccgccgccgacctggaa
ccgctgctcgccgaggtctacctggacctcgccccggtggtgctcgacgcgggggccgac
ttcgccgcgtccggccgggagctgctgcggatctggggcgagcggtccgcgccgggcagc
gagctggcgggcaacctcggcgccgacccgctcggcgtcctcgccgccaccgggcaggag
cccgacaccgccgccctgctcgacctgctgccgcgcctggacccgttcccggccgccagg
ctgatcgccgtcgacgccctcccgcaccacggcgcgggcggctccgacgcgcaggagctc
ggcgcctcgctcgccgcgggcgtggcctacctgcggctgctcaccgacgccgggctcacc
gtcgcgcgcgccgctcggctgctggagttccgctacgcggccaccgccgaccagttcctc
accaccgccaagctccgcgccgcccgcaggctgtgggcccgcgtcaccgaggtgtgcggc
gagccgtccccgcaggtccagcacgccgtgacgtccccggcgatgatgacccgccgcgac
ccgtgggtgaacatgctgcgcaccacgatcgcctgcgcgggcgccgggatgggcggggcc
gacgcgatcaccgtgctgccgttcgaccacgccatcggcctgcccgacgacttctcccgc
cgcatcgcccgcaacacccagtcggtgctgctggaggagtcgcggctgtcggcggtgatc
gacccggcgggcggctcctggtacgtggagcggctcaccgaggacctcgcgcgggccgcg
tggcgctggttccaggagatcgaggccgggggcgggctcgccgccgcgctgcgctccggc
ctggtcgccgaccggctcgccgagacctgggagcgccgccgcgccaacctcgccgaccgc
accgacgccatcaccggcgtcagcgagttcccgaacctgggcgagaagcccgtcgtgcgc
cgcccagccccgccggaacccggcggcgggctgcccgtgatccggtacgcccaggacttc
gaggcgctgcgcgaccgcgccgacgccgcccccgagcggccgaaggtcttcctggccacg
ctcggaccggtcgccgcgcacaccgcccgcgcgaccttcgccgccaacctgctccaggcg
ggcggcgtcgagaccccgcaggccggtcccacgaggaccgccgacgacgtcgtcgcggcg
ttccgcgccagcggcgcccgcgtcgcctgcctgtgcggcagcgagagctcctacgcggag
ctggccgcccccgtcgccgacgccctgcgcgcggcgggcgccgagcgcgtcctgctcgcg
ggcaagcgctccgacgcgaccgtcgacgaccacctgttcctgggctgccccgcgctcgac
gtgctcgggcgcaccttcgagtccctcggagtcccacgatga

DBGET integrated database retrieval system