KEGG   Actinosynnema mirum: Amir_6449Help
Entry
Amir_6449         CDS       T00957                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ami  Actinosynnema mirum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ami00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7550646..7551920)
Genome map
AA seq 424 aa AA seqDB search
MSHTAVDVIRAKRDGLRLTDGQVDWVVDAYTRGEVADEQMSALAMAIFLNGMDAAETARW
TRAMIASGDVLDLRVDRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGG
TLDKLESIPGWRAQLSLDEITAQLGSVGAVVCAATTGLAPADRKLYALRDVTGTVEAIPL
IASSIMSKKIAEGADALVLDVKVGSGAFMKTEERARALARALVDIGVDHGRKVTALLTDM
SVPLGAAVGNAIEVAESVDVLRGGGPEDVVELTVALAREMLALAGIDVDPARVLASGEAY
ETWARMIRAQGGDPEAELPVAKHTRVLEAAEDGVLTGLDAYAVGVAAWRLGAGRARKEDP
VQAGAGVRCLVKPGAAVSAGQPIAELYTDTPEAFDAAFETLRGGVELNGEVTERSALVID
TIRG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacaccgctgtcgacgtcatcagggcgaagcgcgacgggctccggctcaccgac
ggccaggtcgactgggtcgtcgacgcctacaccaggggcgaggtcgccgacgagcagatg
tccgcgctcgccatggcgatcttcctcaacggcatggacgccgccgagacggcccgctgg
accagggccatgatcgcgtccggcgacgtgctggacctgcgggtcgaccgccccacggtg
gacaagcactccaccggcggcgtgggcgacaagatcaccctcccgctggccccgctggtc
gccgcgtgcggcgcggcggtgccgcagctgtccgggaggggcctcgggcacaccggcggc
accctggacaagctggagtccatccccggctggcgggcgcagctgtccctggacgagatc
accgcccagctgggctcggtcggcgccgtggtctgcgcggccaccaccggcctggccccg
gcggaccgcaagctgtacgccctgcgggacgtcaccggcacggtcgaggcgatcccgctg
atcgccagctcgatcatgtcgaagaagatcgccgagggcgcggacgcgctggtgctggac
gtgaaggtcggctccggggcgttcatgaagaccgaggagcgggcgcgtgcgctcgcgcgg
gcgctggtggacatcggcgttgaccacggccgcaaggtgaccgcgctgctgacggacatg
tcggtgccgctgggcgcggcggtcggcaacgcgatcgaggtcgccgagtcggtggacgtc
ctgcgcggcggcggcccggaggacgtggtcgagctgaccgtcgccctggcccgcgagatg
ctggcgctggcggggatcgacgtggacccggcgcgcgtgctggcgtccggcgaggcgtac
gagacgtgggcccggatgatcagggcccagggcggcgaccccgaggcggagctgccggtc
gcgaagcacacgcgggtgctggaggccgccgaggacggcgtgctgaccgggctggacgcg
tacgcggtcggcgtcgcggcgtggcggctcggcgcgggccgggcccgcaaggaggacccg
gtgcaggccggggccggggtgaggtgcctggtgaagccgggtgcggcggtgagcgcggga
cagccgatcgcggagctgtacacggacacgccggaggcgttcgacgcggcgttcgagacg
ctgcgcgggggcgtggagctgaacggggaggtcaccgagcgctcggcgctggtgatcgac
acgatccgcggctga

DBGET integrated database retrieval system