KEGG   Actinosynnema mirum: Amir_6463Help
Entry
Amir_6463         CDS       T00957                                 

Definition
Succinate dehydrogenase hydrophobic anchor subunit-like protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ami  Actinosynnema mirum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_6463
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Amir_6463
   00650 Butanoate metabolism
    Amir_6463
  Energy metabolism
   00190 Oxidative phosphorylation
    Amir_6463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7600608..7601024
Genome map
AA seq 138 aa AA seqDB search
MSELALDRPRTPRRPAARRNNFELYSWLFMRLSGVALLVLVLGHLFIMNILDGGVHRINF
GFVAGRWASPFWQIWDLAMLWLAQIHGGNGLRTVINDYARKDATRFWLKMLLYVSMVLII
VTGTYVVFTFDPGIATTN
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactggctctcgaccgcccccgcaccccgcgcaggcccgcggcgcggcgcaac
aacttcgagctgtacagctggttgttcatgcgcctgtccggcgtggcgctgctcgtgctg
gtgctcggccacctgttcatcatgaacatcctcgacggcggcgtgcaccggatcaacttc
ggtttcgtcgcgggccgctgggcctcgccgttctggcagatctgggacctggccatgctg
tggctggcccagatccacggcggcaacgggctgcggacggtcatcaacgactacgcccgc
aaggacgccacccgcttctggctgaagatgctgctctacgtgtcgatggtcctgatcatc
gtgacggggacgtacgtggtgttcacgttcgatcccggcatcgccaccaccaactga

DBGET integrated database retrieval system