KEGG   Actinosynnema mirum: Amir_6728Help
Entry
Amir_6728         CDS       T00957                                 

Definition
(GenBank) Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ami  Actinosynnema mirum
Pathway
ami00860  Porphyrin and chlorophyll metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Amir_6728
Enzymes [BR:ami01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Amir_6728
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Amir_6728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase T_hemolysin DUF2974
Motif
Other DBs
NCBI-ProteinID: ACU40525
JGI: Amir_6728
UniProt: C6WNG1
Position
complement(7860477..7862009)
Genome map
AA seq 510 aa AA seqDB search
MTRARKTPGRVAFVGSGPGDTGLLTVRARDLLGKAELVVTDPDVPAEVVALVPDGVEVRP
AVGEPADVAKDLVAEAKNGAAVVRLVAGDPLTLDSVVKEAHAVSKTTIAFDVVPGVPAGT
AVPAYAGVALGAVHTEADVRGAVDWAGLASATGTLVLHATGGHLAEAASSLVEHGLAPQT
PVAVTADGTGFSQRTVDTTLASLAADAGELSGPLVVTVGSAVANRPKLSWWESRALYGWR
VLVPRTKEQAGAMSDRLHSHGAIPVEVPTISVEPPRSPAQMERSVKGLVDGRYQWVVFTS
TNAVRAVWEKFREFGLDARAFSGVKIACVGEATAAKVRGFGIIPELVPSGEQSSEGLLAD
FPPYDDILDPVDRVLLPRADIATETLAAGLRDRGWEIDDVTAYRTVRAAPPPADTREMIK
SGGFDAVCFTSSSTVRNLVGIAGKPHARTLVACIGPQTAETAREFGLRVDVQPEDANVPA
LVDALAQHAARLRAEGALPPPRKTKRLRRS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcgcgcaagacccccggccgagtcgccttcgtgggctccggcccaggtgac
accgggctcctcacggtccgggcccgcgacctgctcggcaaggccgagctggtcgtgacg
gacccggacgtgcccgccgaggtggtcgccttggtccccgacggcgtcgaggtccggccc
gcggtcggcgagcccgccgacgtggcgaaggacctggtggccgaggccaagaacggcgcg
gcggtggtccggctggtcgcgggcgacccgctgaccctggactccgtggtgaaggaggcg
cacgccgtctccaagaccacgatcgccttcgacgtggtccccggcgtgcccgcgggcacg
gccgtccccgcgtacgcgggggtcgcgctgggcgcggtgcacaccgaggccgacgtgcgc
ggcgccgtggactgggccgggctcgcctcggcgacgggcacgctcgtgctgcacgcgacc
ggcggccacctggccgaggcggcgtcctcgctggtggagcacggcttggccccgcagacc
ccggtcgcggtgaccgccgacggcaccggcttcagccagcgcaccgtcgacaccacgctg
gcctcgctggccgcagacgcgggcgagctgtccggcccgctggtggtcacggtcggcagc
gcggtcgcgaaccggcccaagctgtcctggtgggagtcgcgggcgctgtacggctggcgc
gtgctggtgcccaggaccaaggagcaggcgggcgcgatgagcgaccggctgcactcgcac
ggcgccatcccggtggaggtgccgacgatctccgtcgagccgccgcgcagcccggcgcag
atggagcgctcggtcaagggcctggtcgacggccgctaccagtgggtcgtgttcacctcg
accaacgcggtgcgcgcggtgtgggagaagttccgcgagttcggcctggacgcccgcgcg
ttctccggcgtgaagatcgcctgcgtcggcgaggccacggcggcgaaggtgcgcggcttc
gggatcatcccggagctggtgccgtccggcgagcagtcctccgagggcctgctggccgac
ttcccaccgtacgacgacatcctggacccggtcgaccgggtgctgctgccgcgcgccgac
atcgccaccgagaccctcgcggccgggctgcgcgaccggggctgggagatcgacgacgtg
acggcctaccgcaccgtgcgggccgccccgccgcccgccgacacccgcgagatgatcaag
tccggcgggttcgacgcggtgtgcttcacctcgtcgtccacggtccggaacctggtcggc
atcgcgggcaagccgcacgcccgcacgctggtggcctgcatcggcccgcagacggcggag
acggcgcgcgagttcggcctgcgcgtggacgtgcagcccgaggacgcgaacgtcccggcg
ctggtggacgcgctggcgcagcacgcggcgaggctgcgcgccgagggcgccctgcccccg
ccgcgcaagaccaagcgcctgcgcaggtcctga

DBGET integrated database retrieval system