KEGG   Actinosynnema mirum: Amir_6775Help
Entry
Amir_6775         CDS       T00957                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ami  Actinosynnema mirum
Brite
Enzymes [BR:ami01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Amir_6775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7906577..7907704
Genome map
AA seq 375 aa AA seqDB search
MDLGARFREELVDGMVGEGVLSDPRWVRAFREVPRDAFLPGFFAQREDGAWAPVTRGDPD
WLRLVYRDDVRVTQLDGNDAAWSRALEQGWARGVPTSSSSMPTIMAIMLEALAVVDGCRV
LEIGTGTGYNAALLSAGVGSQSVTTVDVDPSVLSRAQAALAGAGWSPTCALADGAGGWPE
AAPYDRVLGTCAVSRVPLPWLEQTRPGGAVVTTLNRPLGAGLIRLTALGGTRAEGRVLAE
DGRFMPLRAHAAGWAEEALARAATAVPEETRATSLGAHEVVHPGSGYEFFAGLVLRGAVV
TMNPVLLAHEDGSWARPRAGVVSQGGPRRLWTEAEEGHREWQALGRPRRARFGVTVDGED
QRFWLDSPEGRSWPV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcggcgcgcggttccgcgaggagctggtcgacggcatggtcggggagggcgtc
ctctccgatccccgctgggtgcgcgcgttccgcgaggttccgcgcgacgcgttcctgccg
ggcttcttcgcccagcgggaggacggcgcgtgggcgccggtgacacggggtgacccggac
tggttgcggctggtgtaccgggacgacgtgcgggtgacccagctggacggcaacgacgcg
gcgtggtcgcgggcgctggagcaggggtgggcgcgcggcgtgccgacgagctcgtcgagt
atgccgacgatcatggcgatcatgctggaggccctggcggtggtggacggctgccgggtg
ctggagatcgggacggggacggggtacaacgcggcgctgctgtcggcgggggtcggttcg
cagtcggtgacgacggtcgacgtggacccgtccgtgctgtcccgcgcgcaagctgccctg
gcgggggcgggctggtccccgacgtgcgccctcgcggacggcgcaggcggctggccggag
gccgccccgtacgaccgcgtgctgggcacctgcgcggtgtccagggtgccgctgccgtgg
ctggagcagaccaggccgggtggtgcggtggtgaccaccttgaaccgcccgctgggcgcc
ggcctgatccgcctgacggcgctcggcggaacgcgggcggagggcagggtcctggcggag
gacggcaggttcatgccgctgcgggcgcacgcggcggggtgggcggaggaggcgctggcg
cgggcggcgacggcggtcccggaggagaccagggcgacttccctgggggcgcacgaggtg
gtgcaccccgggagcggctacgagttcttcgcgggcctggtcctgcgcggcgcggtggtc
acgatgaacccggtcctgctggcccacgaggacggctcgtgggcccgcccgagagcgggc
gtggtctcccagggcggcccgcggaggctgtggacggaagccgaggagggccaccgcgag
tggcaggccctgggacgaccccggcgggcgcggttcggggtgacggtggacggggaggac
cagcggttctggctggactcaccggaggggcgcagctggccagtgtag

DBGET integrated database retrieval system