KEGG   Actinosynnema mirum: Amir_6798Help
Entry
Amir_6798         CDS       T00957                                 

Definition
heavy metal translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
ami  Actinosynnema mirum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7931636..7933855
Genome map
AA seq 739 aa AA seqDB search
MTTAETGTSRVELAITGMTCASCANRIERKLNKLDGVTASVNYATEKASVEYPDGTDVAD
LVSTVEAAGYGAQAPQQDRAPEPEEDDHAGDLRLRVRLAALLGVPVIVLSMVPAWQFPAW
QWLSFALATTVVWVCGWPFHRAAAVNLRHGASTMDTLVSMGVTVSYLWSAYALVLGGAGE
LGMTHGFSLVPRPSSTGDVYLEVAVGVTLFLLLGRWLEARSKRRAGAALRALLALGAKDV
AVLRDGREVRVPVSELRVGDRFAVRPGERIATDGVVAEGASAVDRSMVTGESAPEEVGVG
DRVVGGSVNAGGLLVVEATGVGEDTQLARMAALVEQAQSGKAEVQRLADRVSAVFVPVVL
GIALVTLVGWLLSGAPVQFAMTATVAVLVIACPCALGLATPTALLVGTGRGAQLGILVKG
PEVLESTRRVDTVVLDKTGTVTTGRPELVDVVPAPGVERAELLRVAGAAEHGSEHPIAAA
VVRGAGAEVGELPPVTGFANEVGVGVSAVLEGRRVEVGRLTSARLPEELVAAGRELEGRG
RTVVAVTANGLPLGLLGVTDAVKPTSAEAVRGLRDLGLRPVLLTGDNEVVARAVAAEVGV
DEVIAGVLPSGKVDAVRRLQEQGRVVAMIGDGVNDAPALAAADLGLAMGTGADAAIEAGD
LTLVRGDLRVAVDAIRLSRRTLRTIKGNLFWAFAYNVAGLPIAALGLLNPMLAGAVMAFS
SLFVVSNSLRLRGFRSTAG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgcggagaccgggaccagcagggtcgagctggcgatcaccggcatgacctgc
gcgtcgtgcgcgaaccggatcgagcgcaagctcaacaagctcgacggggtgaccgcctcg
gtcaactacgccacggagaaggcgagcgtcgagtacccggacggcacggacgtggcggac
ctggtctccacggtcgaggcggccggttacggagcgcaagcaccgcaacaggaccgcgcc
cccgagccggaggaggacgaccacgcgggcgacctccggctgcgggtgcggctcgccgcg
ctgctcggcgtgccggtcatcgtgctctcgatggtcccggcctggcagttccccgcctgg
cagtggctctcgttcgcgctggccaccaccgtggtgtgggtgtgcggctggccattccac
cgcgccgcggcggtcaacctgcggcacggggccagcacgatggacaccctggtgtcgatg
ggcgtcacggtgtcctacctgtggtccgcctacgccctggtgctcggcggcgcgggcgag
ctgggcatgacgcacgggttcagcctggtgccgcgcccgtcgtcgaccggtgacgtctac
ctggaggtggccgtcggcgtgacgctgttcctgctgctcggccgctggctggaggccagg
tcgaagcggcgggcgggggccgcgctgcgggcgctgctggcgctgggcgcgaaggacgtg
gcggtgctgcgggacggccgcgaggtgcgggtcccggtgtccgagctgcgggttggcgac
cggttcgcggtgcggccgggcgagcggatcgcgacggacggggtcgtggccgagggcgcg
tcggcggtggaccggtcgatggtcaccggcgagtcggcgcccgaggaggtcggggtcggc
gaccgggtggtcggcgggtcggtcaacgcgggcggcctgctggtggtcgaggcgaccggg
gtcggtgaggacacccagctggccaggatggcggcgctggtcgagcaggcgcagtcgggc
aaggccgaggtgcagcggctggcggaccgggtgtcggcggtgttcgtgccggtggtgctg
ggcatcgcgctggtgacgctggtcgggtggctgctgtccggggccccggtgcagttcgcg
atgacggcgacggtggcggtgctggtgatcgcgtgcccgtgcgcgctggggctggcgacg
ccgaccgcgctgctggtgggcaccgggcggggcgcgcagctgggcatcctggtcaagggg
cccgaggtgctggagtcgacccggcgggtggacacggtggtgctggacaagaccggcacg
gtgacgaccgggcggccggagctggtggacgtggtgcccgcgccgggcgtggagcgggcg
gagctgctgcgggtggcgggcgcggccgagcacggctcggagcacccgatcgcggcggcg
gtggtgcgcggggccggggccgaggtcggcgagctgccgccggtgaccgggttcgcgaac
gaggtgggcgtcggggtgtcggcggtgctggagggcaggcgggtcgaggtcggccggttg
acgtcggcgcggctgcccgaggagctggtggcggccgggcgggagctggagggccggggc
cgcacggtggtggcggtgaccgcgaacgggctgccgctggggttgctgggcgtgaccgac
gcggtgaagccgaccagcgcggaggcggtgcgcgggctgcgcgacctggggttgcggccg
gtgctgctgaccggggacaacgaggtggtggcgcgcgcggtggccgccgaggtgggcgtc
gacgaggtgatcgccggggtgctgccctcgggcaaggtcgacgcggtgcgacggttgcag
gagcagggccgggtggtcgcgatgatcggcgacggggtgaacgacgcgcccgcgctggcg
gcggcggacctggggctggcgatgggcaccggcgcggacgcggccatcgaggcgggcgac
ctgacgctggtgcgcggcgacctgcgggtcgcggtggacgccatccggttgtcccggcga
acgctgcggaccatcaagggaaatcttttctgggcgttcgcctacaacgtcgccggtttg
ccgatcgcggcgctcggattgctgaaccccatgctcgcgggggccgtgatggccttctcc
agcctgttcgtggtctccaacagcctgcgcctgcgcgggttccgctcgaccgcgggctga

DBGET integrated database retrieval system