KEGG   Actinosynnema mirum: Amir_6923Help
Entry
Amir_6923         CDS       T00957                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ami  Actinosynnema mirum
Pathway
ami00010  Glycolysis / Gluconeogenesis
ami00052  Galactose metabolism
ami00500  Starch and sucrose metabolism
ami00520  Amino sugar and nucleotide sugar metabolism
ami00521  Streptomycin biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_6923
   00052 Galactose metabolism
    Amir_6923
   00500 Starch and sucrose metabolism
    Amir_6923
   00520 Amino sugar and nucleotide sugar metabolism
    Amir_6923
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amir_6923
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Amir_6923
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Amir_6923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACU40718
JGI: Amir_6923
UniProt: C6WR25
Position
8054467..8055366
Genome map
AA seq 299 aa AA seqDB search
MIAVDVGGTETKAALVEASPEGARPVRELRVPTPRRDTGEATARAVVAEVVELGKRLRGA
AEPAAIGLVVPGLVDEASGTGVYSANLGWRDFPFAAEVASAAGLPVAFGHDVRAGGLAEL
RLGAARGSRNAVVLPIGTGIAAALVVDGRVRALPGEVGHVDVGHGDPCGCGQTGCVEARA
SSAAIARRYSSLTGRAVAGAADVAALLRAGDPAAAAVWREAVDALARGILLVAALLGPEL
VVLGGGLALAGPLLTDPLRGRLDELASFQRLPELRLAELGDGAGRLGAALLAIDMLEET
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccgtcgacgtcggcggcaccgagacgaaagccgcgctggtcgaggcctccccc
gagggagcccgaccggtgcgcgagctgcgcgtccccacaccgcgccgcgacaccggcgag
gcgaccgcgcgtgccgtcgtggccgaggtcgtcgagctgggcaagcgcttgcgcggcgcc
gcggagcccgccgcgatcggcctggtcgtccccggtctggtggacgaggcgagcggcacg
ggcgtctactccgccaacctcggctggcgcgacttccccttcgccgcggaggtcgcctcg
gccgcaggcctcccggtcgccttcggccacgacgtgcgcgccggcggtctcgccgagctg
cgcctgggcgcggccaggggctcgcgcaacgccgtcgtgctgcccatcggcaccggcatc
gccgccgcgctggtcgtggacggccgggtgcgggccctgcccggcgaggtcgggcacgtg
gacgtcggccacggcgacccgtgcggctgcgggcagaccgggtgcgtcgaggcgcgggcg
tcgtcggcggcgatcgccaggcggtactcctctctgaccgggcgcgcggtcgcgggggcc
gccgacgtggccgcgctcctccgggcgggcgatcccgccgcggcggcggtgtggcgcgag
gcggtggacgccctggccaggggcatcctgctggtggccgcgctgctcggccctgagctg
gtggtgctgggcggcgggctggcgctggccggtccgctgctcaccgaccccctgcggggg
cggctggacgagctggcctcgttccagcggctcccggaactgcggctggcggagctgggc
gacggggcgggacgcctcggggccgcgctgctggccatcgacatgctggaggagacatga

DBGET integrated database retrieval system