KEGG   Actinosynnema mirum: Amir_6981Help
Entry
Amir_6981         CDS       T00957                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ami  Actinosynnema mirum
Pathway
ami00010  Glycolysis / Gluconeogenesis
ami00020  Citrate cycle (TCA cycle)
ami00620  Pyruvate metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
Module
ami_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_6981
   00020 Citrate cycle (TCA cycle)
    Amir_6981
   00620 Pyruvate metabolism
    Amir_6981
Enzymes [BR:ami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Amir_6981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACU40774
JGI: Amir_6981
UniProt: C6WR81
Position
complement(8115420..8116772)
Genome map
AA seq 450 aa AA seqDB search
MPRYKQFPLPDTAEGLTDAEILTWHVRPGDVVKVNQVIVEIETAKAAVELPCPWDGVVTE
VLVQVGQTVDVGTPIITIDVDPSGAAPAPAPAPAPVNGAAVEESGRVPTLVGYGPKSGAA
KRRPRKGNPAAAAPVAPAVPAPVAAPAPAPVAVAEPVAPQGGYVPLAKPPVRKLAKDLGV
DLRALTGSGPGGVITREDVEASLAAPVAEPAPSAVDSGARERRVPIKGVRKATAQAMVDS
AFTAPHVTEFLTIDVTPMMELRARLKDTPEFRGVKLTPLAFAAKAVVLAARRTPDVNAAW
DGPAGEIVYKDYVHLGIAAATPRGLVVPKVRDADRMSLRELAVALEELATTAREGRTKPS
DMVGGTFTITNVGVFGVDTGTPILNPGESGILALGAIRDMPWVVDGQVVPRKVCQLALSF
DHRVVDGQQGSQFLADVGALLADPAVAITY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcggtacaagcagttcccgctcccggacacggccgaggggctgaccgacgccgag
atcctcacctggcacgtgcggcccggtgacgtggtcaaggtcaaccaggtcatcgtggag
atcgagaccgcgaaggcggccgtcgagctgccctgcccgtgggacggggtggtgaccgag
gtcctcgtgcaggtcgggcagaccgtcgacgtgggcacgccgatcatcaccatcgacgtc
gacccgagcggggcggcgcccgcgcccgccccggcgcctgccccggtcaacggggccgcg
gtcgaggagtccggccgggtgcccacgctcgtcgggtacgggccgaagtccggcgcggcg
aagcgccgcccccgcaaggggaacccggccgcggctgctccggtcgcgcccgcggttccc
gcgcccgtggccgcacccgcgcccgcgccggtcgcggtcgcggaacccgtcgcgccgcaa
ggcgggtacgtcccgctggccaagccgccggtgcgcaagctggccaaggacctcggggtc
gacctgcgcgcgctcaccggctccggccccggcggcgtgatcacccgcgaggacgtcgag
gcgtcgctggccgctccggtcgcggaacccgctccgtccgcggtggacagcggagcgcgt
gagcggcgggtgccgatcaagggcgtccgcaaggcgaccgcgcaggcgatggtggacagc
gcgttcaccgctccgcacgtcaccgagttcctgaccatcgacgtcacgccgatgatggag
ctgcgggccaggctcaaggacaccccggagttccggggcgtcaagctgaccccgctggcg
ttcgcggccaaggccgtcgtgctcgcggcgcggcggaccccggacgtgaacgccgcctgg
gacggtccggcgggcgagatcgtctacaaggactacgtgcacctgggcatcgccgccgcc
accccgcgcgggctggtggtgccgaaggtcagggacgcggaccggatgtcgctgcgcgag
ctggccgtcgcgctggaggagctggccacgaccgcgcgcgagggcaggacgaagccctcg
gacatggtcggcggcacgttcaccatcaccaacgtcggcgtcttcggcgtcgacaccggg
acgcccatcctcaaccccggcgagtcgggcatcctcgcgctcggcgcgatccgcgacatg
ccgtgggtggtggacggccaggtggtgccgcgcaaggtgtgccagctggcgctgagcttc
gaccaccgcgtggtcgacggccagcagggctcgcagttcctggcggacgtcggcgcgctc
ctggccgaccccgccgtggcgatcacgtactga

DBGET integrated database retrieval system