KEGG   Actinosynnema mirum: Amir_7070Help
Entry
Amir_7070         CDS       T00957                                 

Definition
(GenBank) PfkB domain protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ami  Actinosynnema mirum
Pathway
ami00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Amir_7070
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Amir_7070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACU40861
JGI: Amir_7070
UniProt: C6WSJ1
Position
complement(8213696..8214547)
Genome map
AA seq 283 aa AA seqDB search
MAQVLVLGSANADLVVSVPRRPAGGETVLGSDTVVLPGGKGANTAVAAARAGGRVALLGA
VGDDGNGALLRRSLEGAGVDAALVAVSRRPTGAAYIAVTPDGENSIVVAPGANADVVAEA
PWGRFAVLVCSLEVPVPVVEEAVRAASAAGVRVVLNLSPVVGVAPDVLAALDPLVVNEHE
AAELAPSFEGLLELGPRAVVVTLGARGAAVVTRSGVLEAPAPEVDVVDTTGAGDAFAGAL
AVRLAEGRELVDAVRFAVRVAAFSVTRAGAQPSYPTLAELGGP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggtcctcgtgctcgggtcggccaacgccgacctcgtggtgtccgtgccccgg
cgaccggcgggcggggagaccgtgctcggttccgacacggtcgtgctgcccggtgggaag
ggcgcgaacacggccgtggccgccgcccgcgccggtggccgggtggcgctgctcggcgcg
gtcggcgacgacgggaacggcgcgctgctgcggcggtcgctggagggcgccggggtggac
gcggcgctggtcgcggtgtcccggcggccgaccggggccgcctacatcgcggtcacgccg
gacggcgagaactcgatcgtggtcgcgccgggtgccaacgcggacgtggtcgccgaggcc
ccgtgggggcggttcgcggtgctggtgtgctcgctggaggtgcccgtcccggtcgtggag
gaggcggtgcgggcggcgtcggcggccggggtccgggtggtgctgaacctgtcgccggtg
gtcggcgtcgccccggacgtgctggccgcgctggacccgctggtggtcaacgagcacgag
gcggccgagctggcgccgtcgttcgaggggctgctggagctggggccgcgcgcggtggtg
gtgaccctcggcgcgcgcggcgcggccgtggtgaccaggtcgggggtgctggaggcgccc
gcgccggaggtggacgtcgtggacaccacgggggccggggacgccttcgccggggcgctc
gcggtgcggctggccgaggggcgggagctggtggacgcggtgcggttcgcggtgcgcgtg
gcggcgttctcggtgaccagggcgggggcgcagccgtcctacccgacgctggccgaactg
ggcggcccgtga

DBGET integrated database retrieval system