KEGG   Advenella mimigardefordensis: MIM_c23660Help
Entry
MIM_c23660        CDS       T03016                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
amim  Advenella mimigardefordensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:amim00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MIM_c23660 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    MIM_c23660 (fadI)
   00640 Propanoate metabolism
    MIM_c23660 (fadI)
   00650 Butanoate metabolism
    MIM_c23660 (fadI)
  Lipid metabolism
   00071 Fatty acid degradation
    MIM_c23660 (fadI)
   00072 Synthesis and degradation of ketone bodies
    MIM_c23660 (fadI)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MIM_c23660 (fadI)
   00310 Lysine degradation
    MIM_c23660 (fadI)
   00380 Tryptophan metabolism
    MIM_c23660 (fadI)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MIM_c23660 (fadI)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MIM_c23660 (fadI)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MIM_c23660 (fadI)
Enzymes [BR:amim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MIM_c23660 (fadI)
Exosome [BR:amim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MIM_c23660 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2700268..2701551
Genome map
AA seq 427 aa AA seqDB search
MTFKPVYVVDGARTPFLKVRGGPGPFSAADLAVQAARALLLRQPIEPTVLSEVIVGCAAP
TPDETNIGRVVGLRVGTGHRVPAWTVMRNCASGMQALDSACANIQTGRSDLVLACGTDAL
SRAPLLFSDAMVNWLAKWNGAKSTGQKLGLLRQFKLSNLAPVIGLLKGLTDPVIGISMGQ
TAENLAWEFGITRREMDAFSVRSHERAITGRNRHAFAEIEPIIDAKGNAYTEDDGIRNDS
TIEKLGKLKPVFDKPSGSITAGNSSQVTDGGTALLLASEEAVSKWNLQPLGRIVDAQWAA
LDPAQMGLGPVHASVPILQRHGLGLNDLDLWEINEAFAAQVLGCIRAFESEKYCQTHFGI
PALGTLDQDKLNVDGGAIALGHPVGASGARIVLHLLQALRARSLKRGIASICIGGGQGGA
MLVETMQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacattcaaacctgtttatgtcgtcgatggtgccagaacaccctttctaaaagtgcgc
ggtggccccggacctttttctgccgctgatctggcggtgcaggccgcacgtgccctgctg
ctgcgtcagcccatcgagccaacggtcctgtctgaagtcattgtaggctgcgctgcgccg
acccccgatgagaccaatatcgggcgcgtggttggcctgcgcgtgggcacgggccatcgg
gtgccggcctggaccgtcatgcgcaactgcgcctcgggcatgcaggcactcgattcggcc
tgcgccaatattcaaacgggacgttccgacctggttctggcttgcggtaccgatgcactg
tcgcgcgcacccttgctgttttccgatgcgatggtgaactggctggcgaaatggaatggt
gcaaaatccaccggccagaagctgggtctgttgcgccagttcaagctgagcaacctggca
ccggtcatcggcctgctcaaagggctgaccgatccggtgatcggcatttccatgggccag
accgctgaaaatctcgcctgggaatttggcatcacacgtcgcgaaatggatgccttcagt
gtgcgcagccatgaacgtgctattactggccggaaccgccatgcgttcgcggaaattgag
ccgatcatcgacgcaaagggcaatgcctacaccgaagacgacggtatccgcaacgactcc
accatcgagaagctgggtaagctgaaaccggtgttcgacaagcccagcggcagcatcacc
gcaggtaacagctctcaggttaccgatggcggcaccgcgctgctgctcgcttccgaagaa
gccgtcagcaagtggaatctgcagccactgggtcgtatcgtcgacgcccagtgggctgcc
cttgatccggcgcaaatggggctgggacctgtccatgccagtgtaccgatcctgcagcgt
catggcctgggactgaatgaccttgatctatgggaaatcaacgaagcctttgctgcgcag
gtgctgggctgcatccgtgccttcgaaagcgaaaaatactgccagacgcattttggcatc
cctgcgctgggcacactggaccaggacaaattgaatgtggatggcggtgcaattgcgctg
ggtcatccggttggcgcctctggcgcacgcatcgtactgcacctgctacaggcattgcgc
gcacgcagtctcaagcgcggtatcgccagcatttgtattggcggtggtcagggtggcgcc
atgctcgtagaaaccatgcagtaa

DBGET integrated database retrieval system