KEGG   Advenella mimigardefordensis: MIM_c39760Help
Entry
MIM_c39760        CDS       T03016                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amim  Advenella mimigardefordensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amim00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MIM_c39760
Enzymes [BR:amim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MIM_c39760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4578884..4579819
Genome map
AA seq 311 aa AA seqDB search
MSLSHPRIVIVGIYVADLLFKASRMPVIGETLLGSHFAMGPGGKGSNQAVAAARAGAEVI
FYTRLGNDAFAANAQKTWQQAGVTSRATLHDDLTTGAAHIFVEDESGRNAIIVYPGAAAH
MVPADLDLIEQDIASADIFVTQLEQPLDVALHGLRLARKHGVTTIFNPAPATQLPDELFP
LCDWITPNETEASLLTGLPVGNLEQARAAAGRLLAKGVTNVVITLGEQGCLLHTASDSIH
IPAYQAGKCIDTAGAGDGFTAGLATALAEGQPPEAALRFASALAGISVTRSGTAASMPER
GQIDTLLSTSA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcctatctcatccccgtattgttattgtcggcatttatgttgccgatctgctgttc
aaggcaagccgcatgccggttattggcgaaaccctgctgggcagccattttgccatggga
cccggcggcaaaggatccaaccaggccgttgccgcagcccgtgccggggcagaggtgatt
ttctacacccggctgggtaacgatgcctttgccgctaatgcccagaaaacctggcagcaa
gccggcgtcacatcccgcgcgacgctgcacgatgacctgaccaccggcgctgcccatata
ttcgtcgaagacgagagcggccgcaatgccatcatcgtctaccccggcgcggctgcccat
atggtgcctgccgatcttgatctgatcgaacaggatatcgccagtgccgacatctttgtc
acgcagctggagcaacccctggacgtcgccctgcatggtctgcgcctggcgcgcaaacac
ggcgtgaccacgatcttcaacccggccccggcgacccagctgcccgatgagctgttcccg
ctgtgcgactggatcactcccaatgaaaccgaggccagcctgctgaccggactgccggta
ggtaatctggaacaggcgcgggccgcggccgggcggttactggccaaaggcgtcaccaat
gtggtcatcacgctgggtgaacagggctgcctgctgcacacagccagcgacagtattcat
attcccgcgtaccaggcaggcaaatgcattgacaccgccggcgccggtgacggctttacc
gcagggctggctaccgcgcttgccgaaggccagccccccgaggcagccctgcgctttgcc
tccgcgctggccggtatttccgtgacccgcagtggtaccgcagcctctatgcccgagcgc
ggacaaattgataccctgctttcgacgagtgcctga

DBGET integrated database retrieval system