KEGG   Alligator mississippiensis (American alligator): 102559088Help
Entry
102559088         CDS       T03087                                 

Gene name
GBA2
Definition
(RefSeq) glucosidase, beta (bile acid) 2
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102559088 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102559088 (GBA2)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102559088 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 626 aa AA seqDB search
MDVSIMFTLRNGMGTKEDKRGGHWNEPFSMEKEGERVSGVLLHHCIPVNPYTLAISAREK
AGTGVTHITAFNPAGTGQEVWQDLLSDGRLDSPAGKSSHTEKGEATAAAVCARCTVPARG
HGSVELALAWDMPCIQFGSKEKMHLRRYTRYFGSSGDAGPALSHYALTHYEQWEEKIEAW
QKPILEDSQLPPWYKSALFNELYFLADGGTLWVELPPEACAEDVQGPRGAGLSQLFPVLQ
EYGRFAYLEGQEYRMYNTYDVHFYASFALVMLWPKLEISLQYDIAAAVLNEDTQPRLYLM
NGQTAQVKLKNVVPHDIGEPSDEPWQHVNAYLIHDTASWKDLNLKFVLQVYRDYYLTHDS
TYLRDMWPVCQAVMDSELKFDTNNDGLIENAGFADQTYDAWVATGASAYCGSLWLAAVCM
MCKMAEILDDGGVLHKYSAILQKGSEAFERLLWNGKYYNYDSSKGISSTSIMSDQCAGQW
FLRACGLGQGEFEVFPKSHVLSALKTIFEMNVMGFSDGTMGAVNGMRPDGVPDTSSVQSN
EVWVGVVYALAATMIQEGLVQEGFRTAEGCYRTVWERLGMAFQTPEAYCQRKLFRSLAYM
RPLSIWSMQLALESRAGRAPDSPTHE
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgtccatcatgttcactctgaggaatggcatggggaccaaggaggacaagaga
gggggccactggaacgagcccttcagcatggagaaggagggcgagcgggtctctggcgtc
ctgctgcaccactgcatccctgtgaacccgtacaccctggccatctctgccagagaaaag
gctggcactggcgtgacccacatcacagccttcaaccctgcaggcacaggacaggaggtg
tggcaagaccttctctcggacggacggctggactccccggcaggcaagagcagccacaca
gagaaaggggaggcgactgctgcggccgtgtgtgcccggtgcacggtgcctgcccggggg
cacggatcggtggagctggccctggcgtgggacatgccttgtattcaatttggctcgaag
gagaagatgcatctcaggcggtacacacgctactttggcagcagcggcgacgctggccct
gccctttcccactatgcgttgacgcattacgagcagtgggaggagaagatcgaggcctgg
cagaagcccatcctggaggacagccagctgcctccctggtacaagtcggccctcttcaac
gagctgtacttcctggcggacggcgggacgctctgggtggagctgcccccagaggcctgc
gcagaggacgtgcagggtccgaggggggcaggcctgtcgcagctcttccccgtcctgcag
gagtacggacggtttgcgtacttggaagggcaggagtaccgcatgtacaacacctacgac
gtccacttctacgcctcctttgctctcgtcatgctgtggccgaagctggaaatcagcctg
cagtacgacattgctgccgcggtgctgaacgaggacacgcagccccggctgtacctcatg
aacgggcagacggcccaagtgaagctgaagaacgtcgtgccgcatgacatcggggagccc
agtgacgagccgtggcagcacgtcaacgcctacctgatccatgacacggccagctggaag
gacctgaacctgaagtttgtgctgcaggtgtatcgcgattactacctcacccacgactcc
acctacctgcgggacatgtggcctgtctgtcaggcagtgatggattctgagctgaaattt
gacaccaacaacgacgggcttatcgaaaacgctggctttgccgaccagacttacgacgcg
tgggtggcaactggagccagtgcctactgtggcagcctgtggctggcagctgtctgcatg
atgtgcaagatggcggagatcctggacgacggcggggtcctgcacaagtacagcgccatc
ctgcagaagggctcggaggcctttgagaggctgctgtggaacggcaaatactacaattac
gacagcagcaagggcatctcttccaccagcatcatgtcggaccagtgtgcaggccagtgg
tttctccgggcttgcggcctgggccaaggggagtttgaggttttccccaagagccacgtc
ctcagcgcactgaagacaatcttcgagatgaatgtcatgggcttctccgatggcacgatg
ggagccgtgaacggcatgcggccggatggcgtcccggacacctccagcgtgcagtccaac
gaagtgtgggtcggcgtggtgtatgccctggcggccaccatgatccaggagggcctggtg
caggagggcttccgcacggcggagggttgctaccgcaccgtgtgggagcggctgggcatg
gccttccagacgcccgaggcctattgccaaaggaagcttttccggtcgctggcctacatg
cgccccctcagcatctggagcatgcagctggccctggagagcagagcggggcgcgcaccc
gactcccccacccacgagtga

DBGET integrated database retrieval system