KEGG   Alligator mississippiensis (American alligator): 102560471Help
Entry
102560471         CDS       T03087                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102560471
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102560471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 151 aa AA seqDB search
MLLKMKALIFLGFFLLPLAAHEKVYERCELAAAMKKLGLANIPGYSLGEWVCTARYESNF
NTNAINHNSDGSTDYGILQINSRWWCNDGKTPGAKNACRIQCTELMKPDITATVKCAKRI
VKDPQGMNAWVAWKKYCKGKDVSKWIKGCKL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgctgctaaaaatgaaagctctgatttttctgggttttttcctcctgcctctggctgct
catgagaaggtctatgaaaggtgtgagctggctgcagccatgaaaaagcttgggctggct
aacattccaggatactctttaggggaatgggtgtgtacagcaagatatgagagcaacttt
aacacaaatgccataaaccataactctgatggaagcacggattatgggattttgcaaatc
aacagccgctggtggtgcaatgatggaaagactccaggagccaagaatgcatgcagaatc
cagtgcacagagttaatgaaaccagacattactgcaactgttaaatgtgcgaagaggatt
gtcaaagatccacagggcatgaacgcatgggtggcctggaagaaatactgcaaaggaaaa
gatgtctccaagtggatcaaaggctgcaaactgtaa

DBGET integrated database retrieval system