KEGG   Alligator mississippiensis (American alligator): 102562390Help
Entry
102562390         CDS       T03087                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102562390 (ALPL)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102562390 (ALPL)
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102562390 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 524 aa AA seqDB search
MKALLLVLLIELCLGSLFPEKEKNPKYWLDQAQQTLRNALKLQKLNTNVAKNIIMFLGDG
MGISTVTAARILKGQLQHMQGEETMLEMDKFPYVALSKTYNTDAQVPDSAGTATAYLCGV
KANEGTVGVSAAVMRDQCNTTAGNEVTSILKWSKEAGKSVGIVTTTRVNHATPSAAYAHS
ANRDWYSDNEMPPEAIQQGCKDIAQQLFENIPNIEVIMGGGRKYMFPKNTTDVEYQTEDK
YRGTRLDGKTLTSVWKEKKPKDKNAHYVWNRQDLMALNLDKVDFLLGLFEPVDLMXELDR
NNQTDPSLTEMVEVAIKILQKNPKGFFLLVEGGRIDHGHHEGKAKQALHETVEMDRAIGL
AGRLTKENDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMQSDVDKKPFTSILYGNGPGY
KLIGGGRENVSTVDFAHANYQAQSAVPLRQETHGGEDVAIFAKGPMAHLLHGVHEQNYIP
HVMAYAACVGPNTNHCRSGAARGTGVALPLLSTFASLFILLCLF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcttctcctcgtccttctgattgaactttgccttgggtcccttttcccagag
aaggagaagaatccaaaatactggctggaccaggctcagcagacgttgagaaatgccctg
aagctgcagaagctcaacacaaacgtggccaagaacatcatcatgttcctgggagatgga
atggggatctccacggtcaccgcggcacgcatcctcaaggggcagctgcagcacatgcag
ggggaagaaaccatgctggaaatggacaaatttccttacgtggccctgtccaagacctac
aataccgatgcccaagtgccagacagcgccggcacggccacggcttacctgtgcggggtg
aaggccaacgagggaacggtgggggtgagtgccgccgtgatgcgagaccagtgcaacaca
acggcgggcaacgaagtcacgtcgatcctcaagtggtcgaaggaagcgggcaaatctgtg
ggcatcgtcaccaccacgcgagtgaaccacgcaacgcccagcgcagcctacgcccactcg
gccaacagggactggtactcggataacgagatgcccccggaagccattcagcaaggctgc
aaggacattgcccagcagctgtttgagaacatccctaacatcgaggtgatcatgggcggc
ggcaggaagtacatgttccccaagaacaccaccgacgtggagtaccagactgaagacaag
tacaggggcacgcgcctggacgggaaaaccctcaccagtgtctggaaagagaagaaacct
aaagacaagaatgcccattatgtctggaatcgccaggacctgatggctctcaacctggac
aaagtagacttcctcctaggcctcttcgagccagtcgacctgatgtangaactggacagg
aacaaccagacggacccttccctgactgagatggtggaggtggccatcaagatcctccag
aaaaaccccaaaggatttttcctgctggtggaaggaggcaggatcgaccacggtcaccac
gaggggaaagccaagcaagcgctgcacgagaccgtggagatggacagagctatcggcttg
gccggccgcctgaccaaggagaacgacaccctgaccgtggtcacagcagatcactcccac
gtgttcaccttcgggggctacacaccccgcggcaactccatttttggcctggctccgatg
cagagtgacgtggataaaaagcccttcacttccatcctgtacggaaatggccctgggtac
aaactcataggaggaggaagggagaacgtgtccacggtggattttgctcacgccaactac
caggcccagtcggctgtgcccctgcgccaggagacccatggcggtgaggacgtggctatc
tttgccaaggggcccatggctcatcttctgcacggggtccacgagcagaactacatcccg
cacgtcatggcttatgctgcctgcgttggcccaaacaccaaccactgccgctccggggct
gcccgtggcacgggggtggctctgcctctcctctccacctttgcttctctcttcatcctc
ctatgcttgttttga

DBGET integrated database retrieval system