KEGG   Alligator mississippiensis (American alligator): 102564458Help
Entry
102564458         CDS       T03087                                 

Definition
(RefSeq) neuroendocrine convertase 1-like
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102564458
Peptidases [BR:amj01002]
 Serine Peptidases
  Family S8: subtilisin family
   102564458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 438 aa AA seqDB search
MLDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGINQTSADL
HDECTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPLAGNPGWKKNG
AGLMVNSRFGFGLLNAKALVDLADPKAWKSVPEKKECIVKDSSFEPRLLRANGEVTIEIP
TKACEGQENSIASLEHVQFEATIEYSRRGDLHVTLTSPSGTSTVLLAERERDKSPNGFKN
WDFMSVHTWGENPAGTWVLRITDVSRRIQNEGRIVNWKLILHGTSVQPEHMKQPRVYTNY
NAVQNDRRGVEKMTDFVEDHTTQENLKEKSKVTGGTSSSTDKMGDKIPSEAMLHLLQSAF
SRQMSQNRAPKKTPSEKLTIPYEHFYQALEKLNKPSQLRDSEESLYSDYVDLFYNTKSYK
HRDDRLLQALVDILNEEN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctggatggaatagtcactgatgccattgaagccagttcaatcggttttaatccagaa
catgtggatatttacagtgcaagctggggtccaaatgatgatggtaaaactgtagagggt
cctggcagactagcacagaaggcttttgaatatgggatcaaccagacaagtgctgatctt
catgatgaatgtacagagactcacactggaacctctgcatctgctccattggcagcgggg
atttttgctctagcccttgaagcaaaccctaatctaacatggagggatatgcaacatttg
gtagtctggacatcagaatatgacccactggctggtaatccaggatggaagaaaaatgga
gcagggttgatggtgaatagccgatttggatttggattacttaatgccaaggcactggtg
gatttagctgatcctaaagcgtggaaaagtgtgcctgaaaagaaagagtgtatagtcaag
gacagcagttttgaaccaaggttattaagagcaaatggtgaagtaaccatcgaaattccc
acgaaagcttgtgaagggcaagagaattctattgcatctttggaacatgtgcaatttgag
gcaacgattgaatattcccgcagaggtgatctgcacgtcactctcacttccccatcaggc
accagcactgttctactggctgaaagggagagagataagtctcccaatggctttaaaaat
tgggacttcatgtctgttcacacatggggagagaacccagcaggtacttgggttttaaga
attactgatgtgtccaggagaatccaaaatgaagggaggattgtgaactggaaactgatt
ttgcatggcacttctgtccaacctgaacatatgaaacagcctcgtgtatacacaaactac
aatgctgtgcaaaatgacagaaggggagtggagaagatgacagactttgtagaggaccac
accacgcaggagaacctaaaggaaaaatccaaagtcacaggaggtaccagcagtagcact
gataaaatgggagacaaaatcccatcggaggcnatgcttcacctattgcaaagtgctttc
agcaggcagatgtcccagaatcgagcaccaaagaagactccaagtgaaaagttaactatt
ccatatgaacatttctatcaagcccttgaaaaattaaacaagccctcccagttaagagac
tcagaggaaagtctatacagtgactacgttgaccttttttacaacaccaaatcatacaag
catagagatgatagactgctgcaggccttggttgatattttgaatgaagaaaactaa

DBGET integrated database retrieval system