KEGG   Alligator mississippiensis (American alligator): 102565590Help
Entry
102565590         CDS       T03087                                 

Gene name
GBA
Definition
(RefSeq) glucosylceramidase beta
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102565590 (GBA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102565590 (GBA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102565590 (GBA)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102565590 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 586 aa AA seqDB search
MRQPRHTEVLEQPHSRHPSPLGQAVWTSLRLEQPVFTSLSCSQLRVLLTYAGPSRERRAG
SVGTMWAGCAHILAWLLLIQAAPRVAGSWPCSPKYFGKDFMVCECNATYCDTLDPVTLPP
VGTFVKYESSKAGKRLERSEGKVQRNLWAPGFILTLDTAQRYQKVKGFGGSVTDAAAINI
LSLSQKVQDNLLRSYFSEEGIEYNLIRMPMASCDFSVYPYTYDDVPYDYDLVHFRLKHED
TKLKIPVVHRAQAMSKRPISLCASPWTSPTWMKTNGDVKGKGSLKGSAGDKYHKTWANYF
VRFLDEYAKHNLTFWAVTAENEPTAGLIRNYPFQCLGFTPEQQRDFIALDLGPALANSSH
KGIQLIILDDNRIQLPHWAKVVLGDERAARYVNGIGVHWYLDFLAPIEDTVLATHHLFPN
YYILATEACVGSKFWERPVVLGCWDRGNMYSHSILTNLNNYVTGWTDWNLALDLEGGPNW
VKNFVDSPIIVDSRENIFYKQPMFYHMGHFSKFIPEGSQRVGLVASRSCKKCALEYTAFL
RPDGAAIVVVLNRSLRSVDFRLVDNGRVIKATSPAQSIQTYLWRRR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcggcagccccgacacacggaggtactggagcagccccactctcgacacccctcgccg
ctgggccaggctgtgtggacatcgctgaggctggagcagcccgtgttcacctccctttct
tgctcgcagctccgggtgctgctgacatacgcagggcccagccgcgagaggcgggcaggc
agcgttggcaccatgtgggctggctgtgcccacatcttggcctggctcctgctgatccag
gcagcgcccagggtggcaggcagctggccctgcagtcccaagtactttggaaaggacttc
atggtgtgcgagtgcaatgccacgtactgcgacacgctggaccctgtcaccctcccacct
gtgggcactttcgtcaagtacgagagcagcaaggctggcaagcggctggagcgcagcgag
ggcaaggtgcagaggaacctctgggccccaggtttcatcttgaccctggacacggcgcag
cggtaccagaaggtgaagggcttcggcggatctgtcacagacgcagccgcaatcaatatc
ctgtccctgtcccagaaggtccaggacaacctgctgcggtcctacttctccgaggaaggc
attgagtacaacctcatccgcatgcccatggccagctgcgacttctccgtttacccctac
acgtacgatgatgtcccatacgactatgatctcgtgcacttccgtctgaagcatgaggat
acaaagctgaaaatcccggtggtgcaccgggcacaggccatgtccaagaggccgatctca
ctgtgtgccagcccctggacctcccccacctggatgaagaccaatggggacgtgaagggg
aagggcagtctgaagggcagtgcaggtgacaagtaccacaagacctgggccaactacttt
gtcaggttcctggacgaatatgccaagcacaacctgacattctgggcggtgacggcggag
aacgagcccacagctggactgatcagaaactaccccttccagtgcctgggcttcaccccc
gagcagcagcgggacttcatcgcccttgacctaggcccagcgctggccaacagctcgcac
aagggcatccagctcatcatactcgatgacaaccgcatccagctccctcactgggccaaa
gtggtgctgggggatgagcgggctgctcgctatgttaacggcatcggcgtccattggtac
ctggacttcctggcacccatcgaggacactgtgctagctacccaccacctcttccccaac
tactatatcttggccactgaagcctgcgttgggtccaagttctgggagagacctgtcgtt
ctgggctgctgggaccgggggaacatgtacagccacagcatcctgacaaacctgaacaac
tacgtcacaggctggaccgactggaacctggcgctggacctggagggtggccccaactgg
gtcaagaacttcgtggacagccccatcatagttgacagccgagagaacatcttctacaag
cagcccatgttctaccacatggggcacttcagcaagttcatccctgagggctcacagcgt
gtggggcttgttgcttccaggtcatgcaagaagtgtgccctggagtatacggccttcctg
cgccctgatggtgccgccattgtcgtggtcctgaacaggtcgctgaggagtgtggacttc
aggctggtggacaatggccgtgtcatcaaagccacatctccggctcagtctatccagacc
tacctgtggaggcggaggtga

DBGET integrated database retrieval system