KEGG   Alligator mississippiensis (American alligator): 102567925Help
Entry
102567925         CDS       T03087                                 

Gene name
PTGS1, PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102567925 (PTGS1)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102567925 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 594 aa AA seqDB search
MAKPSLSVSLAMMLSVCLAVGSPSTVDPCCYFPCQHQGVCVRVGLEGYECDCTRTGYFGT
NCTLPEFWTRIHKLLKPSPAFYHFVLTHFKWFWDIINSTFIRDTLMTLVLKIRANLIPSP
PTYNSDYGYISWEGYANVSYFTRVLPPVPDDCPTPMGTKGKKELPDPQLLAERFLLRRTF
EKDPQGTNLMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDTLERQHQLRLF
RDGKLKYQVVDGEVYPPTVLQAPVHMIYPNGTAQHQQLAVGQEVFGLLPGLMMYATLWLR
EHNRVCDMLKQEHPTWGDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLRLKFDPELLF
GVQFQYRNRIAVEFNQLYHWHALMPDAFVIQGQEYSYKQFIYNTTMLTDYGIEELVEAFS
KQHAGRIGGGQSINGNLLKVAIGLINESRQLRLQPFNEYRKRFGMRPYASFQELTGEEEK
AAQLAELYGDIDALEFYPGLLLEKPQANAIFGESMVEIGAPFSLKGLLGNPICSPEYWKP
STFGGATGFALVQTASLQKLVCNNVRRCPYVSFHVPDPSPEPAEHSAAQPSTEL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccaagtctctccgtctcgctggcgatgatgctgagcgtgtgcctggccgtg
gggagccccagcacagtggatccctgctgctacttcccctgccagcaccaaggcgtgtgc
gtgcgggtcggcctggagggctacgagtgtgactgcacgcgcaccgggtacttcgggacc
aactgcaccctgcctgagttctggacgcgcatccacaagctgctgaagcccagcccggct
ttctaccacttcgtgctgacccacttcaagtggttctgggacatcatcaacagcaccttc
atcagggacacgctgatgacgctggtgctgaaaatccgggccaacctgatccccagcccc
cccacctacaactcggactacggctacatcagctgggagggctacgccaacgtgagctac
ttcacccgcgtcctgccgccggtgcccgatgactgcccgacgcccatggggaccaaaggg
aagaaggagcttcccgacccccagctcctggctgagaggttcctgctccgacggacgttt
gagaaggacccgcagggcaccaacctgatgttcgccttcttcgcccagcacttcactcac
cagttcttcaagacatccgggaagatgggacgcggcttcaccaaggctctgggccatggg
gtggatctcgggcacttgtacggggacaccctggagcgtcagcaccagctgcggctcttc
agagacgggaagctcaagtaccaggtggtggacggggaggtgtacccgcccacggtgctc
caggcgccagtgcacatgatctaccccaacggcaccgcccagcaccagcagctggccgtg
ggccaggaggtgtttgggctcctgcccgggctgatgatgtacgcaaccctctggctccgc
gagcacaaccgcgtctgtgacatgctgaagcaggagcacccgacgtggggcgacgagcag
ctcttccagacggcccggctcatcctcatcggggagaccatcaagatcgtcatcgaggac
tacgtgcagcacctgagcgggtacttcctgcgcctgaagttcgaccccgagctgctgttc
ggggtgcagttccagtaccgcaaccgcatcgccgtggagttcaaccagctctaccactgg
cacgcgctcatgccggacgccttcgtcatccaggggcaggagtacagctacaagcagttc
atctacaacaccaccatgctcacggactatggcatcgaggagctggtcgaggctttctcc
aagcagcacgccggacggatcggcgggggacagtccatcaacggcaacctcctgaaagta
gccatcgggctcatcaacgagtcccggcagctgcggctgcagcccttcaatgagtaccgc
aagaggttcggcatgaggccctacgcatccttccaggagctgacaggagaggaggagaag
gcggcgcagctggcggagctgtacggcgacatcgacgccctggagttctacccggggctg
ctgctggagaagccgcaagccaacgccatctttggggagagcatggtggagatcggggcc
cccttctccctcaaggggctgctggggaaccccatctgctcccccgagtactggaagccc
agcaccttcggcggcgccaccggcttcgcgctggtgcagacagcgtcgctgcagaagctg
gtgtgcaacaacgtgcgacggtgcccgtatgtgtccttccacgtgccggaccccagcccg
gagccggctgagcacagcgcggcccagccctccacagagctctag

DBGET integrated database retrieval system