KEGG   Alligator mississippiensis (American alligator): 102568851Help
Entry
102568851         CDS       T03087                                 

Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102568851
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102568851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 295 aa AA seqDB search
EVSVLVAAVVVGASVLLLVFKAARTRAPIALRDPNAKYPLALVEKEEISHDTRRFRFRLP
SPDHVLGLPIGQHVYLSAKINGSLVIRAYTPVSSDEIKGYVDLIIKVYYKNVNPKFPEGG
KMSQYLNSMNIGDTIDFRGPNGLLVYKGPGKFAIKPDKKSEAQIKFAKHLGMIAGGTGIT
PMLQLIRHITKDPKDDTKCYLLFANQTEKDILLRTELEEVAKKHPSQFKLWYTLDRPPQD
WKYSSGFITADMIKAHPPPGNDSIILMCGPPPMIQFACQPSLDKLGYSKNNIFAY
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gaggtgtccgtgctcgttgcggcggtggtcgtgggcgcctcggtcttgctgctcgtcttc
aaggcggcgaggacgcgcgcccccattgcgctgagggatcccaatgccaagtatccgctg
gccctggtggagaaagaggagatcagccatgataccaggcgtttcaggtttcgacttcca
tcgccagatcacgtattgggtttacctataggccaacatgtttatctttctgccaaaatc
aatggtagtttggtgatccgggcctatacaccagtttccagtgatgaaataaaaggttat
gttgatttaattataaaggtctactacaagaatgtcaatcccaagttccctgaaggtgga
aagatgtcccaatacttaaacagcatgaacattggagatactattgacttcagagggcca
aatggacttcttgtgtataaggggccaggtaaatttgctatcaagcctgacaagaagtct
gaagcacagataaagtttgcaaagcatcttgggatgatagctgggggaacaggaattaca
ccgatgttgcagctaattcgtcacatcacaaaggaccccaaggatgacacaaaatgttac
ctactttttgctaatcagacagaaaaagacatactattaagaacagagctagaggaggtt
gctaagaagcaccccagtcaatttaaactgtggtacacactggacaggcctcctcaagat
tggaaatacagctctggtttcatcactgcggacatgattaaagcacatcctccacctggc
aatgattccatcattctgatgtgtgggccacctcctatgattcagtttgcttgtcagccc
agtctggacaaactgggttattccaaaaataacatatttgcttattaa

DBGET integrated database retrieval system