KEGG   Alligator mississippiensis (American alligator): 102572708Help
Entry
102572708         CDS       T03087                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102572708
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102572708
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102572708
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102572708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 555 aa AA seqDB search
MPSRRTGPSHGSRAGSVGAMWATYASVLGWLLLVQVAPEAAGSHPCNARNFGHGSLVCEC
SATYCDTLDPVTLPPAGTFLMYESNKAGKRLERSKGGVQRSLTAPGFRLTLNTTERYQKV
KGFGGSITDSAAINILSLSQEAQNKLLRSYFSEEGIEYNLIRVPMASCDFSVRLYTYADM
RGDFALKHFSLTEEDTKMKIPILQHAQAMSRKPVSLYASPWTSPTWMKTNGAMTGRGTLK
GKPGDKYHKTWANYFIKFLDEYAKHNLTFWAVTSGNEPTAGEIVFYPFQCLGFSPEHQRD
FIARDLGPALANSSHKGIQLIMLDDQRVMLPYWAEVVLKDPVAASYINGIGIHWYLDFLA
PIDLTLSMTHHLFPNYYLLSTEASTGSYFWEPRVILGGWDRGSKYSHSILTNLNNYVTGW
TDWNLALDLEGGPNWSKNYVDSPIIVDSSKDLFYKQPMFYHMGHFSKFLPEGSQRVGLAA
EQKCYQCELEYSAFLRPDGAAVVVVLNRTPKDISFVISDPGIGFIDAEAPADSVQTYLWM
RQKGDPGRPPQGPQA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgagacgcacagggcccagccatgggagtcgagcaggcagtgttggcgccatg
tgggctacctatgccagtgtcctgggctggctcctgctggtccaggtggctcctgaggca
gcaggcagccacccctgcaatgcccgcaacttcgggcatggctcgctggtgtgcgagtgc
agtgccacatactgcgatacgctggaccctgtcacccttccgcctgccggcaccttcctc
atgtacgagagcaacaaagctggcaagcggctggagcgcagcaagggcggggtgcagagg
agcctcacggccccaggcttccgtctcaccttgaacaccacggagaggtaccagaaggtg
aagggctttggcggctccatcacagactcagccgcgatcaacatcctgtccctgtcccag
gaggcccagaacaagctgttgcggtcctacttctctgaggaaggcatcgagtacaacctc
atccgtgtgcccatggccagctgtgacttctccgtccgcctctacacgtacgcggacatg
cggggggacttcgccctcaagcacttcagcctgaccgaggaggacaccaagatgaagatc
ccgatccttcagcacgcgcaggccatgtcccggaagccggtctcgctctatgccagcccc
tggacctccccgacctggatgaagaccaatggggccatgactggcaggggcacgctgaag
gggaagccaggcgacaagtaccacaagacttgggccaactacttcatcaagttcctggat
gaatacgccaagcacaacttgactttctgggcagtgacgtccgggaatgagcccacagcc
ggggagatcgtcttctaccccttccagtgcctgggcttctcccctgagcaccagcgggac
ttcattgcccgtgacctgggccccgcgctggccaacagctcgcacaagggcatccagctc
atcatgctcgatgaccagcgcgtgatgctgccctactgggctgaggtggtgctcaaggac
ccagtggctgccagctacatcaatggcatcggcatccactggtacctggacttcctggca
cccattgacctcacgttgtccatgacccaccatctcttccccaactactacctcctgtcc
accgaggcctccacgggctcctacttctgggagccccgggtgatcctggggggctgggac
cgtggtagcaagtacagccacagcatcctgacgaacctgaacaactacgtcacgggctgg
accgactggaacctggcgctggacctggagggtggccccaactggagcaagaactacgtg
gacagccccatcatcgtagacagcagcaaggacctcttttacaagcagcccatgttctac
cacatgggccacttcagcaagttcctgcccgagggctcacagcgtgtggggctggccgca
gagcagaagtgctaccagtgcgaactggagtactcagccttcctgcgccccgatggtgct
gctgtggttgtggtgctgaacaggacccccaaggacatatcctttgtgatctctgaccct
ggcattggcttcattgatgcagaggctccagccgactccgtccagacctacctgtggatg
cggcagaaaggggacccaggaaggcccccccagggtccccaagcatag

DBGET integrated database retrieval system