KEGG   Alligator mississippiensis (American alligator): 102573115Help
Entry
102573115         CDS       T03087                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102573115
Enzymes [BR:amj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102573115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 293 aa AA seqDB search
MYFALLQEYKYLLRKTESIIESTMRILFLLATVALGWAQYNPNTRPGRTSIVHLFEWSWT
DIALECERYLAPNGFGGVQISPPSENVIITNPWRPWWERYQPVSYKLCTRSGNEDEFIDM
VTRCNNVSVHIYVDAVINHMCASGLGSENNATCGSYFNAKTRDFPAVPYSGWDFNDDKCK
TGSGGIDNYGDLEQVRDCRLVSLLDLALEKDYVRSKIAEYMNYLIDIGVAGFRIDAAKHM
WPGDMKATLDKLKDLNTDWFSPGSRPFIYQEVIDLGGESIKSSEYFGNGRVTE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtactttgccctcttgcaggaatacaaatatttactgagaaaaacagaatctattatc
gaaagcaccatgaggatcctctttctgctagcaactgtagcacttggttgggcacaatat
aatccaaatacaagacccgggaggacatctattgtccatctctttgaatggagttggacc
gatattgctcttgaatgtgaacgctacttagcgcctaatgggtttggtggagttcagata
tctcctccaagtgaaaatgttatcattactaatccatggagaccctggtgggaaagatac
cagccagtcagctacaagctttgtacacgatctggtaatgaagatgaatttatagacatg
gtgaccagatgcaataacgttagtgttcatatttatgtggatgctgtaataaaccacatg
tgtgcatctggtcttggctctgaaaacaatgcgacctgtggaagttatttcaatgcaaag
acaagagattttcctgctgtgccgtactcaggctgggactttaatgatgacaaatgtaaa
actggaagtgggggcatcgacaattatggggatcttgaacaggtccgtgactgccgcctg
gttagtcttcttgatcttgcactggagaaagactatgtacgttcaaagattgctgaatac
atgaactaccttattgatattggtgtagcaggcttcagaattgatgctgccaagcacatg
tggcctggggacatgaaggcaactttagataaactgaaagatttaaatactgattggttt
tctccaggatcgagacctttcatttaccaagaggtaattgacttaggtggagaatcaatc
aaaagcagcgagtactttggaaatggccgagtgacggaa

DBGET integrated database retrieval system