KEGG   Alligator mississippiensis (American alligator): 102576744Help
Entry
102576744         CDS       T03087                                 

Gene name
SCD
Definition
(RefSeq) stearoyl-CoA desaturase (delta-9-desaturase)
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    102576744 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102576744 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102576744 (SCD)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102576744 (SCD)
Lipid biosynthesis proteins [BR:amj01004]
 Desaturase
  First
   102576744 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 358 aa AA seqDB search
MPALVMQEKLSKDFPLATSTITARVTRNGEAVMEKNLSNPEEMSVARDMTDDIFDESYRE
KEGPKPAKRYVWRNIILMSVLHVGGLYGISLIPSAKLMTLGWGIICFMVSALGVTAGAHR
LWSHRSYKATWPLRIFLAVANSMAFQNDIYEWARDHRVHHKFSETDADPHNASRGFFFSH
IGWLLVRKHPDVIEKGKTLDLSDLRADKVVMFQRRYYKPSVVIMCFLVPTIVPWYFWGES
LVISYFIPAILRYAVVLNATWLVNSAAHMFGNRPYDQNINPRENRFVVLGALGEGFHNYH
HTFPFDYSTSEFGWHYNFTTAFIDLMYFVGLASDCKMASKEVIRARKIRTGDGSHKTG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcgtgatgcaggagaagctctccaaggatttccctttagccaccagcacc
attactgcaagggtgacaaggaatggggaagcagtcatggagaagaacttgtccaaccct
gaggaaatgtcagttgcccgtgacatgacagatgatatctttgatgagagctaccgtgaa
aaggagggccccaagcctgccaaaagatatgtctggagaaatatcatcctcatgtctgtg
ctgcatgtaggaggcttatatgggatctccctgataccttcagcaaaactgatgactctg
ggatggggtatcatatgttttatggtgagtgccttgggggtaaccgctggagcgcatcgc
ctctggagtcatcggtcctacaaagcaacttggcccctcagaatcttcctggctgttgcc
aactccatggccttccagaatgacatctacgagtgggcccgagatcaccgtgttcaccac
aagttttctgagacagacgcagaccctcacaatgccagccgcggcttcttcttctcccac
atcggctggctgctagtgcgcaaacatcctgatgtcattgaaaagggcaagacactagac
ctgtctgatctgagggctgacaaagtggttatgttccagaggaggtactacaagccttca
gtggtgatcatgtgcttcttggtgcccaccatagtgccctggtatttctggggggaatcc
ttggtcatcagctacttcatccctgctatcctgcgctacgctgtagtgctcaatgccacc
tggttagtcaacagtgcagcccatatgtttggcaaccggccctatgatcaaaacatcaac
ccgcgggagaatcgctttgtcgtcttgggagccttaggagaaggattccacaattaccac
cacaccttcccctttgactattccacgagtgaattcggctggcactacaactttacaaca
gcttttatcgatcttatgtacttcgtgggtctggccagcgactgcaagatggcgtccaag
gaagtcatccgggctcggaagattcggactggagatgggagccacaagactggctga

DBGET integrated database retrieval system