KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_00510Help
Entry
AMBLS11_00510     CDS       T02260                                 

Definition
uroporphyrinogen-III synthetase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMBLS11_00510
Enzymes [BR:amk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AMBLS11_00510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(127535..128266)
Genome map
AA seq 243 aa AA seqDB search
MLLFTRPLPKLKASASAFEKAGIDAVGVATSDIIDVSSERKAAAEFLATNAVNAIVVTSV
YAVDTVVSGLRDATGDLPLVIAVGEATARKLQAGLQTFSSAQVAIPDAHTSEGILAMHQL
NEANCQHVVIIKGEGGRDVIANGLDAKGILVNSFSVYKREQLTRPVYTKRWKMDEVNGII
ATSEAMALQLIAQFGTALKSIKWLTVSDRIAKGLVSQGINEVAVCQRATDQALIAWVKDN
WEY
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgtttacacgcccactgccaaagttaaaagctagtgcgtcggcttttgaaaaa
gccggcatcgatgcggtaggcgtagccacgtctgacattattgatgtctcgtctgaacga
aaggctgctgcagaatttttagcgacaaacgcagtaaacgctattgttgttaccagcgta
tacgcagtagatacggttgtttcaggcttacgtgatgcgacgggtgatttgccgttagtg
attgctgtaggcgaagctactgcgcgaaaattacaagcagggcttcaaacgttttcatcg
gcgcaggtcgctattcccgacgcccatacatccgaaggtatactggcaatgcatcaactt
aatgaggcaaactgtcagcatgtcgttattattaaaggtgaaggtggtcgcgacgtcata
gcgaatggactcgatgcaaaaggtattttagtaaatagctttagcgtttataaaagggag
caacttacacgcccagtttacacaaaacggtggaaaatggacgaagttaacggcattatc
gctacaagcgaagcaatggcactgcaactgatagcgcaatttggtactgcacttaaatct
attaaatggttaacagtaagcgaccgaattgcaaaaggcctcgttagccaaggtatcaac
gaggtcgcggtttgtcagcgagccaccgatcaggcactcatcgcctgggtaaaggataac
tgggagtattga

DBGET integrated database retrieval system