KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_00530Help
Entry
AMBLS11_00530     CDS       T02260                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AMBLS11_00530
Enzymes [BR:amk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AMBLS11_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131541..132182
Genome map
AA seq 213 aa AA seqDB search
MASLLGNLFILAAPSGAGKSSLIKALMEKYEGNTDTPMQVSVSHTTRQPRPGEVDGVHYH
FVSREQFEALIEQGVFFEYAEVFGNYYGTSRVTIEQTLHRGIDVFLDIDWQGARQVKKLM
PDTCGIFILPPSLDVLEQRLNNRGQDSDEVIAGRMAQAVAEMSHFNEFDSVIVNDDFATA
LNDLEAIVIAQRLRTVKQQMRHQVLLDELLGSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactactcggcaacttatttattcttgctgctccttcaggggcaggaaaatca
agccttataaaggcgctaatggaaaagtatgaaggcaatacagacacgcctatgcaggta
tctgtatctcatacaacacgtcaacctcgtcctggtgaagtcgacggtgtgcactatcat
tttgttagccgagagcagtttgaagcactgattgaacagggtgtgttttttgaatacgca
gaggtatttggaaactattacggcacatcccgtgtgacgattgaacaaactttgcaccgt
ggtattgacgtatttttagatattgattggcagggcgcgcgccaagtcaaaaagcttatg
ccagatacgtgtggtatttttattctgcctccatcacttgatgtgcttgagcagcgtttg
aataatcgcggtcaggacagtgatgaggtgatagcagggcgtatggcacaagccgtggct
gaaatgtctcatttcaatgaatttgacagtgtgattgtgaacgatgactttgcgacagcg
ctgaacgatctagaagctatcgttattgcacagcgtctgcgcacggtaaaacaacaaatg
cgccaccaagtgctattggacgaactgctcggtagcgcgtaa

DBGET integrated database retrieval system