KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_00920Help
Entry
AMBLS11_00920     CDS       T02260                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBLS11_00920
   00052 Galactose metabolism
    AMBLS11_00920
Enzymes [BR:amk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AMBLS11_00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216739..217758
Genome map
AA seq 339 aa AA seqDB search
MKINVSAFGEVAGEVVNAFTLSNDNGMSVTLLNYGGIIKEIQVPNAEGELVSCVQSYNTL
QDYIDDPSYRGAIVGRYANRIGHGTFTLNGVQYALDKNGGAHNLHGGLAGFHKKVWAAKT
QESDDKVSVIFTLTSPDGEGGFPGTVNVEACYSLNQDNELCLVITANTDQETPLSFTQHA
YFTLSNDAKVGNTLLHIDADKVTDADTTLLPTGDLVDVANTPFDFTTLTAIKQRAEQINS
HPLFDRVEGYDHNYVLRNAPEHSPQAIVKALDTGITMALFTNLPGLQFYTGGLKSDDQLG
ALCLEPQHFPDAPNKPEFPNCFVKPGETFTASMRYKFSA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaacgtatctgcttttggtgaagtagcaggcgaagtcgtaaacgcctttact
ttatctaacgacaacggcatgtcagttaccttgctcaattacggcggaattattaaagag
attcaggttccgaatgcagaaggcgaactggtgagttgcgttcaaagttacaacacactg
caagattatattgacgacccaagttatcgtggcgctattgtaggtcgctatgcaaacaga
ataggccacggcacatttaccttaaacggtgttcaatacgcgttagacaaaaatggcgga
gcgcataatctccatggtggactagcaggctttcacaaaaaagtatgggcggcaaaaacg
caagaatctgatgacaaagttagcgttatttttaccttaactagcccagatggggaaggt
ggctttcctggaactgttaacgttgaagcttgttactccctcaatcaggacaacgaatta
tgccttgtgatcaccgcaaacacagaccaggaaaccccactgagttttacacaacatgct
tatttcacattgagtaatgacgctaaggttggtaatacgctgttgcatatagatgccgac
aaagtaacagatgctgataccactttattgccaacaggggatttggtcgatgtcgccaac
acgccctttgacttcacaacgctaacggccataaaacaaagggcagaacaaattaattcc
cacccattgttcgaccgggtagaaggttacgatcataattatgtcttgcgtaatgcgccg
gagcatagcccccaagcaatagtaaaggcacttgatacaggtattactatggcactattt
actaacttgcctggactgcagttctacaccggtgggcttaagagtgatgatcagcttggt
gccctgtgcttagaaccccagcacttcccggacgcacccaacaagcctgagtttccaaac
tgctttgttaagccaggagaaacgttcacggcaagcatgcgatataagttcagcgcgtaa

DBGET integrated database retrieval system