KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_02135Help
Entry
AMBLS11_02135     CDS       T02260                                 

Definition
(GenBank) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMBLS11_02135
Enzymes [BR:amk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AMBLS11_02135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Esterase LCAT
Motif
Other DBs
NCBI-ProteinID: AFT77019
UniProt: K0CU65
Position
507645..508622
Genome map
AA seq 325 aa AA seqDB search
MNWTFTSENNLASTFATHINPFWQSSVTQGHFSGKDNIKVRFAHCIPDSPRATIVICSGR
IESYLKYKEFIYDLYQNGFAVFILDHRGQGLSDRMTRDPQHGYVAHFDDYVDDFVMFVET
IVKPLQQGPLQLVCHSMGGAIGALTLLRLPKLFSKAVLASPMFGIKPALPNWLANGLIRT
GLAVNRMKKKDAGYFFGQTPYIAFPFSLNKLTHSKTRYALFRELYDEEQDIQLGGVTTEW
LAAAHQAMNKIESSARAITTPSLVLSADDDAIIDNNRQRRVAQLMPNAKLEIVPRAYHEL
FTESDDIRERSMARILDFLTEDSLK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaactggacgttcacgtctgaaaataacttagccagcacctttgccacgcacattaac
cctttttggcaaagcagtgttactcaaggtcacttctctgggaaagacaatatcaaggta
cgctttgcgcactgtatcccagattcgccgcgggctacgatcgtaatatgctctggtcgg
atcgaatcctatttaaaatacaaagagttcatttacgatctttatcaaaatggattcgct
gtattcatcttagatcacagaggccaaggcttatcagacaggatgacccgcgatcctcag
catggttatgttgcccatttcgacgactacgttgatgacttcgtcatgtttgtagaaact
attgtaaagccactacagcaaggcccgttacagctggtatgccattcgatgggcggcgcc
attggtgcgctgacgctactgcgtcttccgaaattgttttcaaaagccgttttagcttcg
cccatgtttggcattaaacccgctctgcccaattggttggcgaatggcttaattcgcaca
ggccttgcggtaaacaggatgaaaaagaaagatgcggggtacttctttggtcaaaccccg
tatattgcgtttcctttttcacttaataagctcacccacagcaaaacccgctatgccctg
tttcgtgagctgtatgacgaagaacaggatattcaacttggcggcgtgactacagagtgg
ttagcagcggcacatcaggcaatgaataaaattgaaagtagcgcacgcgctattacaacg
ccttcgcttgtattaagtgcagacgatgacgcgattattgataacaaccgtcagcgccgc
gttgcgcagcttatgccaaatgccaagcttgaaatagtgccccgcgcttaccatgagcta
ttcaccgagtctgacgatattcgcgagcgctccatggcgcgtattctcgactttttgaca
gaagactcacttaaataa

DBGET integrated database retrieval system