KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_02305Help
Entry
AMBLS11_02305     CDS       T02260                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMBLS11_02305
Enzymes [BR:amk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AMBLS11_02305
Exosome [BR:amk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMBLS11_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
540980..541978
Genome map
AA seq 332 aa AA seqDB search
MTSSPFPHRRMRRLRAKDALRGLVAEHRLTTDDLIYPVFVLPGENAREAVPSMPGVERLS
IDLLVQETAKWVELGIKTIALFPVTPMSLKTECASEAFNPEGLAQKAMRALKQAFPEVML
MSDIALDPFTSHGQDGLLDESGYVMNDETVEVLIKQALSHAEAGADIVAPSDMMDGRIGS
IRKALEEAGHINTCIMAYSAKYASAYYGPFRDAVGSAANIKGGNKKTYQMDPANTDEALH
EIALDIEEGADMVMVKPGMPYLDVVRRCKDEFKVPTFAYQVSGEYAMHKAAFANGWLNED
AVILESLLAFKRAGADGILTYFAPQAAALLAK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttcacctttccctcatagacgaatgcgccgtttacgcgccaaagatgcttta
agaggacttgtggcagaacaccgtttaacgactgacgatctcatttatcctgtatttgta
ctacctggcgaaaatgcacgtgaggctgtgccttccatgcctggtgtagaaagactttct
atcgatttacttgtgcaggagactgcgaagtgggttgaattaggtattaaaacgattgcg
cttttcccggtcacgccaatgtcgcttaaaactgaatgtgcaagcgaagcatttaaccct
gaaggacttgctcagaaagcaatgagagccttaaagcaggcgtttcctgaagtaatgctg
atgtctgacattgcattagacccttttacctctcacggacaagacggccttcttgatgag
agcggctatgtaatgaacgatgaaacggtagaggtactgattaagcaagcgctatcgcat
gccgaagcgggagccgatattgttgcgccttcagatatgatggacggtcgcataggaagt
attcgtaaggcgcttgaagaagccggtcatattaatacgtgcattatggcttattcagca
aagtacgcgtctgcgtattacggcccgtttcgcgatgcagtcggttcggccgcaaatata
aaaggcggtaacaagaaaacctatcaaatggaccccgcaaataccgatgaagcacttcac
gaaattgccctagatatcgaagaaggcgctgacatggtgatggttaagccgggtatgccg
tatttagatgtggttcgacgctgcaaagatgagttcaaagtgccaacatttgcataccaa
gtgagtggcgaatacgccatgcataaagcggcttttgccaatggctggttgaacgaagac
gcggtaattctagagtcgctgttagcgtttaaacgcgctggcgccgacggcattctcacc
tatttcgccccgcaggctgcggcgctattagctaagtag

DBGET integrated database retrieval system