KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_02630Help
Entry
AMBLS11_02630     CDS       T02260                                 

Definition
dihydrofolate reductase type I, trimethoprim resistance
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:amk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
609394..609891
Genome map
AA seq 165 aa AA seqDB search
MIAAMAKNRIIGADNDMPWHLPADLKHFKAITLGKAVIMGRKTYESIGRALPGRPNIVIT
SNADYSLSDATVVDSPESAFEVAKALSPEQSENDEVMIIGGGTIYQSFLDKADTLYLTHI
DLDVDGDTQFPDYEAAASWKEVSREAHSADEKNAHSYTFVTLVRN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgctatggcgaaaaacagaattataggtgccgacaatgatatgccgtggcat
ttaccggctgatctcaagcactttaaagctatcaccttgggcaaggcagttataatgggc
cgtaaaacctatgagtcaattggaagggcactgccaggcagaccaaacatagttatcaca
agcaatgcagactacagtctgtctgacgctacagtggtcgattcgcctgagtcagccttt
gaggttgctaaagcattgagcccagagcagagcgaaaatgatgaagtaatgattattggt
ggcggtactatttaccaatcgtttctggataaagcagacaccttgtacctcacgcatatc
gatttagacgttgatggcgatacgcagtttccagactatgaagcagcagcaagttggaaa
gaagtgtcgcgagaggcgcacagtgccgatgagaaaaatgcgcactcttacacattcgtt
actcttgtcagaaactaa

DBGET integrated database retrieval system