KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_02650Help
Entry
AMBLS11_02650     CDS       T02260                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
amk  Alteromonas macleodii Black Sea 11
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(612535..613170)
Genome map
AA seq 211 aa AA seqDB search
MRASRKGDALAELLYNEGIRSQAVLNAIAGTPRESFLPDALKHKAYQNTALPIGQGQTIS
QPYIVAKMTELLLDSPNKPEKVLEIGTGSGYQTAILAQLFAKVFSVERIKSLQFQAKRRM
NQLDLHNIAMKHGDGWKGWASKGPYDAIIVTAAAASLPQDLCDQLKEGGRLIIPVGNEQQ
SLLCIDRIEGELTTSTIESVRFVPLVAGELM
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttctagaaaaggagacgcgttagcagaactgctttacaacgagggaatacgt
tcgcaagcagtattaaacgccattgctggtacgccgcgggaaagctttttacccgatgcg
ctgaaacacaaagcctatcaaaatacggcgttaccgataggtcaaggccagacaatttcg
caaccatatattgttgcgaaaatgactgagttgctgctggatagccctaataaacctgag
aaagttttagaaataggcacgggctctggttatcaaactgctattctggcgcaactattt
gccaaagtattcagtgttgaacgtattaagtcattgcagttccaagcgaagcgtcgaatg
aatcaactcgaccttcacaacattgcaatgaaacacggtgatggttggaagggctgggcg
tccaaaggtccttatgatgctattatcgttactgccgctgctgcgagcctgcctcaggac
ttgtgcgatcagcttaaagaaggcgggcgactcattatacccgtaggcaacgaacaacaa
tcgttgctatgtattgataggattgaaggtgaactaacgacatcgaccattgaatcggtc
cgatttgttccccttgtagcaggagagctaatgtga

DBGET integrated database retrieval system