KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_03385Help
Entry
AMBLS11_03385     CDS       T02260                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amk  Alteromonas macleodii Black Sea 11
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
798927..799649
Genome map
AA seq 240 aa AA seqDB search
MKAVKKVLLASVVAAGSLLGLSAQAADEAAIRNKLSSMLGLDVETIADSPVSGLVQVSTN
RGLFYVSENGQYLLQARVFNIDEEMRNETELALSGLRKEGVKEMESSSITFKAKNEKHEI
SVFTDITCGYCRKFHNEIDELNDAGITVHYLAFPRSGLNSENYNDMVSVWCAKDPQKALT
KAKAGNDVASASCKNKVAEQYMLGQKLGVNGTPNIVLPDGSLIPGYQPAALLAKALEEVE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagtaaagaaagtattgttagccagtgtagttgcggcgggatcattattaggt
cttagcgcgcaggcagctgacgaagccgctatccgcaacaagttatcgtcaatgttaggg
ttggatgtagaaaccattgccgactctccagtatctggcttggtccaagtatctacaaac
cgcggcttattttatgttagtgaaaacgggcagtatctgcttcaggcccgcgtgtttaac
attgatgaagaaatgcgtaatgaaacagagctggcgctttctgggctgcgcaaagaaggc
gtaaaagagatggaatcatcgtctattacgtttaaggccaaaaacgaaaagcatgagata
agcgtatttaccgatattacgtgtggttactgccgtaaatttcacaacgagattgatgaa
ctcaacgatgcaggcattaccgtacactacctcgcgttcccacgttctgggctaaacagt
gaaaactacaacgacatggtatctgtctggtgtgccaaagacccgcaaaaagcgttaact
aaagccaaagcaggtaacgacgtggctagcgcaagctgtaaaaacaaagtggcagagcag
tacatgttaggtcaaaaattaggggtgaacggcacgccaaatatcgtattgccagacggt
tcacttattcctggttatcagccagctgcgcttcttgctaaagcattagaggaagttgag
tag

DBGET integrated database retrieval system