KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_03655Help
Entry
AMBLS11_03655     CDS       T02260                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:amk00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:amk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846366..847628
Genome map
AA seq 420 aa AA seqDB search
MDKLVIKKSPALNGTVRISGAKNAALPLLMTSLLTDSPCRYTNVPRLRDINTTTALLREL
GVEVALPAPNDIVIDASTLQSVTASYELVRTMRASILVLGPLLAKQGKANVSLPGGCAIG
ARPVNLHLTGLEKMGAKIEVDEGYIRAEVDGRLKGARIFMDMVSVGATENLLMAAALADG
TTILENAAREPEIVDLANCLIQMGAKITGAGSDKITIEGVETLNGCDYAVLPDRIETGTF
LVAAAVTGGKIRCTHAAPDTLDAVLDKLEQAGAKITTGEDWIELDMEGRKPQAVRVKTAP
HPAFPTDMQAQFVTLNCVAEGTGVITETIFENRFMHVPELQRMGAEIALEANSAVSKGSS
SLKGAPVMATDLRASASLVIAGLIAEGETHVNRIYHLDRGYEAIEEKLGGLGAIIERVKE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggataaactcgtaattaaaaagagccctgcgcttaacggtacagtgcgtatctctggt
gctaaaaacgcggcgctgccattgttgatgacaagcctacttaccgattcaccttgtcgt
tataccaacgttcctcgtcttcgagacatcaatacaaccacggcgctgctgcgcgagttg
ggtgtagaagttgcgctaccggcgcctaacgatattgttattgatgccagcacactgcaa
agcgttacagcgtcttatgagttagtacgtactatgcgcgcatctatcttggtgcttggg
ccgttactagctaagcaaggcaaagcaaacgtgtctttacctggcggttgtgccatcggt
gcccgtccagtaaaccttcatttgacgggccttgaaaagatgggcgcaaagattgaagtc
gatgaaggctacatccgtgctgaagttgatggccgcctgaaaggtgcgcgcatctttatg
gatatggtgagtgtaggagcaactgagaatctactcatggcggcggctttggctgacggc
accactatcttagaaaatgcggcacgcgaacctgaaattgttgatttggcaaactgtctt
attcagatgggtgcgaaaatcactggtgctggaagcgataaaattaccattgaaggcgta
gaaaccttaaacgggtgcgactatgcagtattgcctgaccgcatagaaacgggaactttc
ttggtagctgccgcggtaacaggcggcaaaatacgctgtactcatgctgcgccagataca
ttagatgctgtgctagacaagctagaacaagccggtgccaaaatcacaacaggtgaagac
tggattgagctagacatggaagggcgcaagccgcaagcagtgcgtgttaaaaccgcacct
cacccagcattccccacggatatgcaggcgcagtttgttaccctaaactgtgttgccgaa
ggtacaggtgtaatcacagaaaccatttttgagaaccgctttatgcacgtacctgagtta
cagcgcatgggcgcggaaatcgcattagaagcgaattcagcggtatcgaaaggcagctcg
agtcttaaaggtgcgccggtaatggcaactgatcttcgtgcgtcggcaagcttggtaata
gccggcttaattgcagaaggcgagactcacgtaaaccgtatatatcacctagaccgtggt
tatgaagctattgaagagaagttaggtggcctaggtgccatcatcgagcgagtgaaagaa
taa

DBGET integrated database retrieval system