KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_04120Help
Entry
AMBLS11_04120     CDS       T02260                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
amk  Alteromonas macleodii Black Sea 11
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976069..977199
Genome map
AA seq 376 aa AA seqDB search
MAVTSLSLRTEKRAQLAFQVGVVFCFTMVIGACSKSPTPYSWNLPHNIPPPPVPADNPLT
EESIILGEKLFFDKGLSASNTISCSSCHDPEHAFAEPKTVSVGANGDALNRNALALVNVA
YNASFTWAHNNLESIEKQLMIPLFNEHPVEMGVTGNEKRILKRFEGSEYRALFEAAYGDD
TPNLNNIVKALASYVRSLVSFNSAFDNYAYAQDDDALTPQQLEGLNLFFSERTECFHCHG
GLNFTQSSKHSFQPFTAQPFHNTGLYNEDGKGSYPESDMGLYSVTHNNDDMGKFRAPTLR
NIALTAPYMHDGSIATLDEVIEFYARGGNVAESPNPYRSPFIKSFAISEDEKAALVAFLQ
SLTDEEFVKTHAKRKK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtaacttcgctttcacttcgcactgaaaagcgagcacaactcgcttttcaggtt
ggcgtagttttctgttttactatggtgataggtgcctgcagtaaatcgcccacgccatac
tcttggaatttgcctcacaatattccaccgccccccgttccggccgacaatcctctgacc
gaagaaagcataatattgggagagaagcttttctttgataaaggcttaagtgcaagcaat
acgatatcttgtagcagctgccatgacccagagcatgctttcgctgaacctaaaacggtt
tcagtaggcgcgaacggagatgcgctaaaccgtaatgcattagctctagtaaacgtggcc
tataatgcatcgttcacttgggcacacaacaatttagaaagcatagaaaagcagttaatg
atcccgctttttaacgaacatccagtggaaatgggcgtaacgggaaatgaaaagcgcata
ttaaagcgctttgagggaagcgaatatcgagcgctatttgaggcggcttatggtgatgat
acccccaatttaaataatatagtgaaggcgctcgcgagctacgtaagaagtttagtgtcg
tttaatagtgcttttgataactatgcttacgctcaagatgacgatgcattaactccccag
cagcttgaaggtttgaatctgtttttttcagagcgcacagagtgcttccactgccacgga
ggtctgaacttcactcaatcatcaaagcatagctttcaaccttttaccgcccagccgttt
cacaacacggggctatataatgaagatggaaagggcagctacccagaatcagatatgggg
ctttacagcgttacacacaataatgatgatatggggaagtttagagcgcctactttacgc
aatatagccctgactgcaccctatatgcatgatggcagcattgccacgcttgatgaagtc
attgagttttatgctcgaggtggaaatgtcgctgaaagccctaatccttaccgcagtccg
ttcataaaaagctttgcgatttcagaggatgaaaaggctgcgctggtcgcatttttgcaa
agtttaaccgacgaggaatttgtaaaaacacacgccaaacgcaaaaaatag

DBGET integrated database retrieval system