KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_05070Help
Entry
AMBLS11_05070     CDS       T02260                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMBLS11_05070
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AMBLS11_05070
Enzymes [BR:amk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AMBLS11_05070
Two-component system [BR:amk02022]
 CheA family
  CheA-CheYBV
   AMBLS11_05070
Bacterial motility proteins [BR:amk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AMBLS11_05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1183229..1184359
Genome map
AA seq 376 aa AA seqDB search
MVFKVLVVDDSTFYRRRVREILDGDRELEVVGEARNGRDALEKAEALKPDVITMDVEMPV
MDGISAVKAIMEKRPTPILMFSSLTHHGAQATLDALEAGALDFLPKKFEDIAQDRKDASR
LLCTKVRLIARRGIGLKRPSFRSVETRKLPDNAPKQAFFKTSGLLSGHKDAAKQPTVSSV
RATGKQYKCLAIGASTGGPVALQKVLAPLPADFPYPILLVQHMPGTFTTAFAQRLDTNCK
VKVKEAEHGDILKPGHAYLAPGGKQMLLESVGANKRIAIVDANANDKVNYKPSVDLTFSS
LAKAYGGDVLGIILTGMGADGREGCRMLKEKGATIWAQDQDSCVVYGMPQAVAVANISSK
NINIDDMSSCVQTEMR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtctttaaagtccttgtcgtggacgactcgactttttatcgtcgtcgagtaagagaa
atactcgatggcgatagggaacttgaagttgttggggaagcgagaaatgggcgtgatgca
cttgaaaaagcagaggcgctcaagcctgatgtaattacaatggacgttgaaatgcctgtc
atggacggtatttcagctgtgaaggccataatggaaaaacggccaacgccaattctcatg
ttttcctcgcttacgcatcacggtgcgcaagcgacattagatgctctagaagcgggagca
ctcgatttcttacctaagaaatttgaagatatagcacaagatagaaaagacgcgtcgcga
ttgttgtgtacgaaagtccgtttaattgcgcgccgaggaattgggctaaagcgtccctct
ttccgctctgttgaaacaagaaagttacccgataacgcacctaaacaggcgttcttcaaa
acgtcgggcttgctttcggggcataaggatgcggccaaacaacccactgtttcgtctgtc
agagcaacggggaaacagtataagtgtttggcgattggggcttccacgggcgggcctgtt
gcgcttcaaaaagtgctcgctccgttacccgcagattttccttatcctattttgcttgta
caacatatgcctgggacattcaccacggcatttgctcagcgactagacacaaactgcaaa
gttaaagtgaaagaagcagagcatggtgacattttaaaacctggtcatgcttatcttgct
ccaggcggaaaacagatgttgcttgagtcagttggtgcaaataagcgcatcgctattgtc
gacgctaatgccaatgataaggtgaattataaacccagtgtggatctcacttttagctcc
ttagctaaggcctatggtggggatgtattgggaattatattaacgggtatgggagctgac
ggcagagaaggatgtcggatgctcaaggaaaaaggcgcgaccatttgggcgcaggatcaa
gactcttgcgtagtctatggtatgccgcaagctgtggccgttgccaatatatccagcaaa
aatataaatattgatgatatgagcagttgcgttcaaaccgaaatgcgatag

DBGET integrated database retrieval system