KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_05865Help
Entry
AMBLS11_05865     CDS       T02260                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00071  Fatty acid degradation
amk00280  Valine, leucine and isoleucine degradation
amk00281  Geraniol degradation
amk00310  Lysine degradation
amk00362  Benzoate degradation
amk00380  Tryptophan metabolism
amk00410  beta-Alanine metabolism
amk00640  Propanoate metabolism
amk00650  Butanoate metabolism
amk00903  Limonene and pinene degradation
amk00930  Caprolactam degradation
amk01040  Biosynthesis of unsaturated fatty acids
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01120  Microbial metabolism in diverse environments
amk01130  Biosynthesis of antibiotics
amk01200  Carbon metabolism
amk01212  Fatty acid metabolism
Module
amk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMBLS11_05865 (fadJ)
   00650 Butanoate metabolism
    AMBLS11_05865 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    AMBLS11_05865 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    AMBLS11_05865 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMBLS11_05865 (fadJ)
   00310 Lysine degradation
    AMBLS11_05865 (fadJ)
   00380 Tryptophan metabolism
    AMBLS11_05865 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMBLS11_05865 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMBLS11_05865 (fadJ)
   00281 Geraniol degradation
    AMBLS11_05865 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMBLS11_05865 (fadJ)
   00930 Caprolactam degradation
    AMBLS11_05865 (fadJ)
Enzymes [BR:amk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AMBLS11_05865 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMBLS11_05865 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AMBLS11_05865 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AFT77761
UniProt: K0D1M6
Position
1379603..1381744
Genome map
AA seq 713 aa AA seqDB search
MTNEVQPTSGAFTLTKQDNGVAILSMDVLGESMNTLKAEFGDEISAMLDDIERDSSIKGV
VLTSGKPSSFVAGADITMLAACKTAEDATTIAAGGQAIFDRIENMKATFVAAIHGPALGG
GLELALACHYRVCTDSPSTQLGLPEVQLGLLPGSGGTQRLPRLIGIQQAMKMMLTGAPAR
AKQAKKYGIVDDVVPHSVLLKVAEQFALKRKPEREAPQKSVMDKVLEKTGPGRSMMFKKA
REATFAKTKGNYPAPGYIIDVIETGMNDGMKAGLKAEAEAFGKLVMTPESFQLRQIFFAT
TEMKKENGVEGVKPEKMNKVGVLGGGLMGGGIAYVTSTKAGVPVRIKDVRAEGIANAMKY
SYDILNKKVKKRFMRNSEMQKQLALLTGTLDYSGYQDADIVVEAVFEDLDLKQKMVADIE
ENCKESTIFASNTSSIPITQIAAKAARPENVIGLHYFSPVDKMPLAEVIAHDKTSDQVIS
STVEFAKKQGKTPVVVKDGAGFYVNRILAPYMNEAANLILDGEPIEHIDKSLVKFGFPVG
PVKLLDEVGIDVGTKIIPFLVEAFGERFTAPSAFDKVLADGRKGKKNQKGFYSYEGKKPG
KEVDESIYELLGLSPSAKLSEKEVAERCVLMMLNEAARCLDEGVIRSARDGDIGAIFGIG
FPPFLGGPFRYMDTLGIKHVVARLNHYATAVGDKFAPAEVLVKMAENDQKFYN
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaagttcagccaacatcaggcgcatttacgttaaccaagcaagataatggc
gttgctattcttagcatggacgtacttggcgagagcatgaatacgcttaaagctgagttt
ggcgatgagatatctgccatgcttgatgatattgagcgcgacagcagcattaaaggtgtt
gtactaacgagcggcaagccaagctcattcgtagcaggtgccgatatcaccatgctagca
gcgtgtaaaaccgctgaagacgccacaactatcgctgcgggcggccaagctattttcgat
agaattgaaaatatgaaggctaccttcgttgcggctatccatggcccagcgttaggtggt
ggtttagaacttgccttagcgtgtcattatcgcgtatgtacagattcacctagcacccag
ctaggtctacctgaagtgcagcttggcttattgccgggcagtggcggcactcagcgtctt
cctcgcctaatcggcattcagcaagcaatgaaaatgatgcttactggcgcccctgcgcgt
gctaaacaagctaaaaaatacggcattgtagatgatgtagtaccgcacagtgttttactt
aaagttgctgagcaatttgcgcttaaacgcaaaccagaacgtgaagcgccgcagaagagc
gtaatggacaaagtgcttgagaaaactggcccaggccgcagcatgatgtttaaaaaggct
cgcgaagcgacatttgccaaaaccaaaggtaattatccagcgccgggttacataattgat
gtcatcgaaacaggcatgaacgacgggatgaaagcggggcttaaagccgaagctgaagcc
tttggtaagcttgttatgacaccggaatctttccaattacgccagattttcttcgcaaca
acagaaatgaaaaaagaaaacggcgttgagggtgttaaacccgaaaagatgaataaagta
ggcgtacttggcggtggtttaatgggcggtggtatcgcctatgtaacgtcgaccaaagca
ggtgtacctgttcgtattaaagacgtacgtgcggaaggtatcgccaatgcaatgaagtac
agctatgacatcttaaacaaaaaggtgaagaagcgtttcatgcgtaacagcgaaatgcag
aagcagttagcgctactcactggtacacttgattacagcggctatcaagatgctgatatc
gtggttgaggcggtttttgaagacctcgaccttaagcaaaagatggtggcggatattgaa
gagaactgcaaagagagcacgatcttcgcgtctaatacatcgtctattccaatcacacaa
attgcagctaaagcagcacgtcccgaaaacgtgattggtctgcattacttctcgccagta
gacaaaatgccattggctgaagttatagctcacgacaaaacgtctgatcaagttatttcg
tctacggtagagtttgctaaaaagcaaggcaaaacgccggtagttgttaaagacggtgcg
ggtttctacgtaaaccgtatcttagcgccttacatgaatgaagcggcaaaccttattctt
gacggtgagcctattgagcacatcgataagtcattggttaagtttggcttcccggtaggc
cctgtgaaactacttgatgaagtgggcattgatgttggtactaagattatcccattcctt
gtagaggcgttcggcgagcgcttcactgccccaagtgctttcgataaagtacttgcagat
ggcagaaagggtaagaaaaatcaaaaagggttttattcttatgaaggtaaaaagccaggt
aaagaagtggacgagtcaatctacgaattactgggtctttcaccttctgctaagttaagc
gaaaaagaagtagcggaacgctgcgtattaatgatgctcaacgaggcggcacgctgtttg
gatgagggcgttatccgcagtgcccgtgacggcgatatcggtgctatctttggtattggt
ttccctccattcttaggcggtccattccgctacatggatacgctgggaattaaacacgtt
gttgctcgtttaaaccattatgctactgctgtgggcgataaatttgcacctgcggaagtg
ttagtgaaaatggcggaaaacgatcagaaattttataattaa

DBGET integrated database retrieval system