KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_05865Help
Entry
AMBLS11_05865     CDS       T02260                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_05865 (fadJ)
   01212 Fatty acid metabolism
    AMBLS11_05865 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMBLS11_05865 (fadJ)
   00650 Butanoate metabolism
    AMBLS11_05865 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    AMBLS11_05865 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    AMBLS11_05865 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMBLS11_05865 (fadJ)
   00310 Lysine degradation
    AMBLS11_05865 (fadJ)
   00380 Tryptophan metabolism
    AMBLS11_05865 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMBLS11_05865 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMBLS11_05865 (fadJ)
   00281 Geraniol degradation
    AMBLS11_05865 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AMBLS11_05865 (fadJ)
Enzymes [BR:amk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AMBLS11_05865 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMBLS11_05865 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AMBLS11_05865 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1379603..1381744
Genome map
AA seq 713 aa AA seqDB search
MTNEVQPTSGAFTLTKQDNGVAILSMDVLGESMNTLKAEFGDEISAMLDDIERDSSIKGV
VLTSGKPSSFVAGADITMLAACKTAEDATTIAAGGQAIFDRIENMKATFVAAIHGPALGG
GLELALACHYRVCTDSPSTQLGLPEVQLGLLPGSGGTQRLPRLIGIQQAMKMMLTGAPAR
AKQAKKYGIVDDVVPHSVLLKVAEQFALKRKPEREAPQKSVMDKVLEKTGPGRSMMFKKA
REATFAKTKGNYPAPGYIIDVIETGMNDGMKAGLKAEAEAFGKLVMTPESFQLRQIFFAT
TEMKKENGVEGVKPEKMNKVGVLGGGLMGGGIAYVTSTKAGVPVRIKDVRAEGIANAMKY
SYDILNKKVKKRFMRNSEMQKQLALLTGTLDYSGYQDADIVVEAVFEDLDLKQKMVADIE
ENCKESTIFASNTSSIPITQIAAKAARPENVIGLHYFSPVDKMPLAEVIAHDKTSDQVIS
STVEFAKKQGKTPVVVKDGAGFYVNRILAPYMNEAANLILDGEPIEHIDKSLVKFGFPVG
PVKLLDEVGIDVGTKIIPFLVEAFGERFTAPSAFDKVLADGRKGKKNQKGFYSYEGKKPG
KEVDESIYELLGLSPSAKLSEKEVAERCVLMMLNEAARCLDEGVIRSARDGDIGAIFGIG
FPPFLGGPFRYMDTLGIKHVVARLNHYATAVGDKFAPAEVLVKMAENDQKFYN
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaagttcagccaacatcaggcgcatttacgttaaccaagcaagataatggc
gttgctattcttagcatggacgtacttggcgagagcatgaatacgcttaaagctgagttt
ggcgatgagatatctgccatgcttgatgatattgagcgcgacagcagcattaaaggtgtt
gtactaacgagcggcaagccaagctcattcgtagcaggtgccgatatcaccatgctagca
gcgtgtaaaaccgctgaagacgccacaactatcgctgcgggcggccaagctattttcgat
agaattgaaaatatgaaggctaccttcgttgcggctatccatggcccagcgttaggtggt
ggtttagaacttgccttagcgtgtcattatcgcgtatgtacagattcacctagcacccag
ctaggtctacctgaagtgcagcttggcttattgccgggcagtggcggcactcagcgtctt
cctcgcctaatcggcattcagcaagcaatgaaaatgatgcttactggcgcccctgcgcgt
gctaaacaagctaaaaaatacggcattgtagatgatgtagtaccgcacagtgttttactt
aaagttgctgagcaatttgcgcttaaacgcaaaccagaacgtgaagcgccgcagaagagc
gtaatggacaaagtgcttgagaaaactggcccaggccgcagcatgatgtttaaaaaggct
cgcgaagcgacatttgccaaaaccaaaggtaattatccagcgccgggttacataattgat
gtcatcgaaacaggcatgaacgacgggatgaaagcggggcttaaagccgaagctgaagcc
tttggtaagcttgttatgacaccggaatctttccaattacgccagattttcttcgcaaca
acagaaatgaaaaaagaaaacggcgttgagggtgttaaacccgaaaagatgaataaagta
ggcgtacttggcggtggtttaatgggcggtggtatcgcctatgtaacgtcgaccaaagca
ggtgtacctgttcgtattaaagacgtacgtgcggaaggtatcgccaatgcaatgaagtac
agctatgacatcttaaacaaaaaggtgaagaagcgtttcatgcgtaacagcgaaatgcag
aagcagttagcgctactcactggtacacttgattacagcggctatcaagatgctgatatc
gtggttgaggcggtttttgaagacctcgaccttaagcaaaagatggtggcggatattgaa
gagaactgcaaagagagcacgatcttcgcgtctaatacatcgtctattccaatcacacaa
attgcagctaaagcagcacgtcccgaaaacgtgattggtctgcattacttctcgccagta
gacaaaatgccattggctgaagttatagctcacgacaaaacgtctgatcaagttatttcg
tctacggtagagtttgctaaaaagcaaggcaaaacgccggtagttgttaaagacggtgcg
ggtttctacgtaaaccgtatcttagcgccttacatgaatgaagcggcaaaccttattctt
gacggtgagcctattgagcacatcgataagtcattggttaagtttggcttcccggtaggc
cctgtgaaactacttgatgaagtgggcattgatgttggtactaagattatcccattcctt
gtagaggcgttcggcgagcgcttcactgccccaagtgctttcgataaagtacttgcagat
ggcagaaagggtaagaaaaatcaaaaagggttttattcttatgaaggtaaaaagccaggt
aaagaagtggacgagtcaatctacgaattactgggtctttcaccttctgctaagttaagc
gaaaaagaagtagcggaacgctgcgtattaatgatgctcaacgaggcggcacgctgtttg
gatgagggcgttatccgcagtgcccgtgacggcgatatcggtgctatctttggtattggt
ttccctccattcttaggcggtccattccgctacatggatacgctgggaattaaacacgtt
gttgctcgtttaaaccattatgctactgctgtgggcgataaatttgcacctgcggaagtg
ttagtgaaaatggcggaaaacgatcagaaattttataattaa

DBGET integrated database retrieval system