KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_06460Help
Entry
AMBLS11_06460     CDS       T02260                                 

Definition
lipase/acylhydrolase, GDSL family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AMBLS11_06460
Enzymes [BR:amk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AMBLS11_06460
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AMBLS11_06460
Lipid biosynthesis proteins [BR:amk01004]
 Fatty acid synthase
  Component type
   AMBLS11_06460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1519897..1520553)
Genome map
AA seq 218 aa AA seqDB search
MFVKLRYLFAFLLILLIPFQALSDQAEQSDTSENAVLLILGDSLSAAYGLQQHEGWVSLL
QKMWQDDNIPIDIVNAAVSGETTDGGLARFPRLLEQHNPTHVLIELGGNDGLQGHNISKI
KNNLDSLVTVAKESNAVVFLQEMQIPSNYGKRYTQMFTQNFIKVAEAQDVQKIPFFLEEI
ALNKDLMQNDGIHPNAEAQPLIANFMDRHLRSLILGAQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgttaaacttcgttatttgttcgcttttttacttattcttttaataccctttcaa
gcgctatcagatcaagctgagcagagcgacacaagcgaaaatgcggttttacttatctta
ggtgacagtttatccgcggcttatggattacagcaacatgagggttgggtcagtttgtta
caaaagatgtggcaagacgacaacattccgattgatattgtaaatgctgcggtaagcgga
gagaccactgacggtggtttagcgcgatttcctcgtttattagagcaacacaatcctacc
catgtattgattgaactgggtggtaatgacggccttcaggggcacaatatcagtaagatt
aagaataatttagactctctggtaaccgttgcaaaggagagtaatgccgtagtgttttta
caagaaatgcaaattccttctaattacggtaagcgctatacgcaaatgtttacacaaaac
ttcattaaagtagcggaagctcaggacgtgcaaaaaattcccttttttcttgaagagata
gcgctaaataaagacttaatgcaaaacgatggtattcatccaaatgctgaggcacagcct
ttgatcgctaattttatggacagacacttaagaagtttaattcttggcgctcaataa

DBGET integrated database retrieval system