KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_06520Help
Entry
AMBLS11_06520     CDS       T02260                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
amk00260  Glycine, serine and threonine metabolism
amk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amk01100  Metabolic pathways
amk01110  Biosynthesis of secondary metabolites
amk01130  Biosynthesis of antibiotics
amk01230  Biosynthesis of amino acids
Module
amk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMBLS11_06520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMBLS11_06520
Enzymes [BR:amk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMBLS11_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFT77890
UniProt: K0CZN9
Position
complement(1531730..1532911)
Genome map
AA seq 393 aa AA seqDB search
MNQLDTKFGEFGGMYVPELLIPALDQLEKAFLDAKDDPTFNEEFLSLLKDYAGRPTSMTL
TRNLVSNPKVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKKEVIAETGAGQHGVATAL
ACALLGLKARIYMGAKDVERQAPNVFRMKLMGAEVIPVNAGSGTLKDAVNEAMRDWSANY
DKAHYLLGTAAGPHPFPTIVREYHRMIGEETRAQIMEKEGRLPDAVVACVGGGSNAIGMF
ADFIDEPSVRLVGVEPAGKGVHTKEHGATIVTGTKGILHGAYTFIMQDKEGQIEESYSVS
AGLDYPAVGPQHAYLHDIGRAEYVAATDEEALNAFQLLARKEGIIPALESSHALAHALNM
ADEAEEETIIVVNLSGRGDKDLAHVINILGDDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagttagatacaaaatttggtgaatttggtggcatgtacgtgcccgagctactt
attccagcactagaccaactggaaaaagcatttttagatgccaaggacgacccaacattt
aacgaagagtttttatctctgttaaaagactatgcgggtcgcccaacgtcaatgacgtta
actcgcaatctggtaagtaacccaaaggtaaaattatacctaaagcgtgaagacctacta
cacggtggtgcacacaaaactaaccaggtgctaggccaggcgctgctgactaagcgaatg
ggtaaaaaagaagttatcgccgaaactggcgcaggccagcacggtgttgcaaccgcgtta
gcatgtgcattgttggggctaaaagcacgtatttatatgggtgcgaaagacgttgagcgt
caagcgccaaacgtgtttcgtatgaagcttatgggcgcagaggttattcctgtgaatgcc
ggttcaggtacgcttaaagatgccgtaaacgaagccatgcgcgactggtcggcaaactat
gataaagcccactatttgttaggcacagccgcggggcctcacccgttcccgaccattgtt
cgtgaatatcatcgcatgattggcgaagaaactcgcgcacaaattatggaaaaagaaggt
cgcttacctgacgccgtagtagcatgtgtgggcggaggctcaaatgctatcggtatgttt
gcagactttattgatgagccatctgtacgcttagtgggcgttgagcctgcgggtaaaggt
gtgcacaccaaagagcacggcgcaactatcgtgacgggtacaaaaggtattcttcacggc
gcttacaccttcatcatgcaagacaaagaaggccagattgaagagagctactcagtatct
gctggtctcgattaccctgctgttggccctcagcatgcttatcttcacgacattggccga
gcggaatacgtggccgccacagacgaagaagcactgaacgcattccaattgcttgcaagg
aaagaaggtattattcctgcccttgaatcgtcgcatgccttagcgcacgcgcttaatatg
gcagatgaagcggaagaagaaactatcatcgtagttaacttatcaggtcgtggcgacaaa
gatttagcgcacgttatcaacattttaggggacgatttataa

DBGET integrated database retrieval system