KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_06625Help
Entry
AMBLS11_06625     CDS       T02260                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AMBLS11_06625
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AMBLS11_06625
Enzymes [BR:amk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AMBLS11_06625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1555853..1556620)
Genome map
AA seq 255 aa AA seqDB search
MTKRTIFITGGASGIGFGIAESMMKQGHHVIIADINEQAAKEAVTRLAHLDGSASAVAVD
VCDAEQVAALPEVLGKHTVDVLINNAGIQHVSRIEDFPTDKWQQLINIMLVGPALLTQAF
LPAMRKQNYGRIINVGSIHSLVASPYKSAYVAAKHGLLGFAKTIALETGDCDVTINTLCP
AYVKTPLVEKQIAAQAKENNLTEEEVITKIMLEPMPKKQFVSVEELADTASFLMSPSARN
ITGQTMVLDGGWTAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcgcacaatatttatcacgggtggggcaagcggcattggctttggcattgct
gagtcaatgatgaaacaagggcaccatgtgatcatcgccgacataaacgaacaggcagcg
aaagaggctgtgaccagacttgcgcatttagacggttcggccagcgcagtagcggtagac
gtttgcgatgcagagcaagtcgcagcgctacctgaggtactagggaagcataccgttgat
gtgcttataaacaatgccggtattcagcacgtttcacgcatagaggacttccctacagat
aaatggcagcagcttataaatatcatgcttgttggccctgctctgttaacccaagctttt
ttgccagccatgcgcaagcaaaattatgggcgtattatcaatgtaggctctattcactcg
ttggtagcttcgccgtataagtctgcttatgtagcggcgaagcatgggctgttagggttc
gcaaaaactatcgcgcttgaaactggggattgcgatgtaactatcaataccctttgccct
gcctatgtgaaaacaccattggtggaaaaacaaattgcagctcaggcaaaagaaaacaat
cttaccgaggaagaggtaataacaaaaataatgctagaacccatgcctaaaaagcaattt
gttagcgttgaagagcttgcagataccgcaagcttcttaatgtcacccagtgcccgcaat
ataacagggcaaaccatggtgcttgatgggggctggacggctagataa

DBGET integrated database retrieval system