KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_07520Help
Entry
AMBLS11_07520     CDS       T02260                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMBLS11_07520
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AMBLS11_07520
Enzymes [BR:amk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMBLS11_07520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1770865..1771875
Genome map
AA seq 336 aa AA seqDB search
MLDCQAEELLPEEKEKLAHPVVGGVILFSRNYHDKRQLSALVQDIRRFAKQPVLIAVDHE
GGRVQRFREGFTAIPAMGDILRQSEHQDESAAYAKACGLVLAYELKTLDIDFSFAPVLDI
NGVSQVIGDRAFSDNADDVIRLAAHLIQGLKAVNMPAIGKHFPGHGSVAPDSHIALPVDE
REFDEIRSTDMVVFERLIERALLDGVMPAHVIYNQVCHKPAGFSTKWLQDILKQDLGFGG
AVFSDDLSMHGASVAGSYVERAEAALEAGCDMVLACNNPQGAETILDGLETRFANLSNND
LQKQERVMALYDRVMPAGLKDKYDSGVELVKRLSER
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttggactgtcaggctgaagaacttttgcctgaagaaaaggaaaaattagcacacccg
gtggtgggaggcgtaatcttatttagccgtaactatcacgacaagcgtcagctctcggcg
ctagttcaagatataaggcgctttgcgaagcaaccggtgttgattgccgttgatcatgaa
ggaggccgcgttcagcgttttcgtgaaggctttactgccataccagcaatgggcgatatt
ttaaggcagtcagagcatcaagatgaaagtgcggcatacgcaaaagcgtgtggattagta
ttggcttatgaacttaaaaccttagatatcgattttagctttgccccggtgcttgatata
aatggtgtatcgcaagttattggtgacagggcattctcagacaatgctgacgacgttatt
cgccttgccgctcatctaatccaaggtttaaaggctgtaaatatgccggctattggaaag
cactttcctgggcatggcagtgtggcgccagactctcacatagcgttaccagtcgatgaa
cgcgaatttgatgaaatacgcagtaccgatatggtggtatttgaacgcttaatcgagcgt
gcgctgcttgatggcgttatgcctgcccatgttatttataatcaggtgtgccataagcct
gcgggtttttcaactaaatggctgcaggatatacttaaacaggatctaggctttggcggt
gcagtattttctgatgatttgtccatgcacggcgcaagtgtcgcaggaagttacgttgag
cgtgctgaggcagcgctagaagcagggtgcgacatggtacttgcctgcaacaatccgcaa
ggggctgagactatccttgatggattggaaacgcgctttgctaacctgtctaacaacgat
ttacaaaagcaagaacgcgttatggcgctttatgaccgtgtcatgcctgcagggctaaaa
gataaatacgacagtggggttgagctggtgaagcgcttaagcgaacggtag

DBGET integrated database retrieval system