KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_08540Help
Entry
AMBLS11_08540     CDS       T02260                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMBLS11_08540
Enzymes [BR:amk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AMBLS11_08540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2026538..2027362
Genome map
AA seq 274 aa AA seqDB search
MQFGKHFINLSQPHVMGILNVTPDSFSDGGKHANVKQALEHALRMIDEGATFIDVGGEST
RPGAPDVSLQEELDRTIPVIEAVSKNTDCVISIDTSKADVMREAVRAGAGLINDVRALQE
PGALQAAAEAKVPVCLMHMQGQPRTMQDNPEYEDVVKDVGQFLLQRAQICEEAGISKDAI
LFDPGYGFGKSLEHNYALVKHLPTLMALGYPVLVGMSRKSMIGNLLNRKVDERLAGSISL
ATIVAQMGAQIIRVHDVKETADAVNIVKMLNSVK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttggtaagcacttcattaatctgtcacaaccacatgtgatgggcatcttaaat
gttacgcccgattcattctctgacggcggcaaacacgcaaatgtaaaacaagcccttgag
cacgcgcttcgcatgattgatgaaggcgcaacgttcatagatgtcggtggtgaatcaacc
aggcctggtgcacccgatgtttcgttacaggaagaattggatcgcaccataccggttatc
gaagccgtatcgaaaaataccgactgtgtaatttccatcgataccagcaaagctgacgta
atgcgtgaagcggtgagggcaggcgcagggttaattaacgatgtacgcgccctacaagag
ccaggcgcactacaagctgccgctgaagcaaaagtacccgtatgcttgatgcatatgcaa
ggacagcctaggactatgcaagataatccagagtatgaagatgtcgttaaagatgtcggc
cagttcttattgcagcgtgcacaaatctgcgaagaggcaggcatttctaaagatgctatt
ttgtttgacccaggctacggattcggtaaatcactagaacataactatgccttagttaaa
caccttccaacacttatggctttgggttatccagtgttagtgggtatgtcacgtaagtcg
atgattggcaatttactcaacagaaaagtggatgagcgcttggcgggaagcataagcctc
gctacaattgttgcccaaatgggcgcacaaataattcgcgttcacgacgtgaaagaaaca
gcagatgctgtcaatatcgtgaaaatgctgaattcagtaaaataa

DBGET integrated database retrieval system