KEGG   Alteromonas macleodii Black Sea 11: AMBLS11_08550Help
Entry
AMBLS11_08550     CDS       T02260                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amk  Alteromonas macleodii Black Sea 11
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBLS11_08550
   01230 Biosynthesis of amino acids
    AMBLS11_08550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBLS11_08550
   00051 Fructose and mannose metabolism
    AMBLS11_08550
   00562 Inositol phosphate metabolism
    AMBLS11_08550
Enzymes [BR:amk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AMBLS11_08550
Exosome [BR:amk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AMBLS11_08550
  Exosomal proteins of bladder cancer cells
   AMBLS11_08550
  Exosomal proteins of melanoma cells
   AMBLS11_08550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2028812..2029555
Genome map
AA seq 247 aa AA seqDB search
MSKNLRKPFVAGNWKMNGNLALVAEFNQKLANVKAESEIVICAPSLLLHAFETQSFAIGA
QNVSHLNNGAHTGELSVEMLKEAGCGYAIVGHSERREDQGESSKLVALKAKQCVSSGVVP
IICVGEPLEVREAGNVEAYVGEQLDALIDAMSVEELSKTVIAYEPIWAIGTGKTASPEQA
QEVHEFIRGYFAKVDAQLAQGLRILYGGSVKPDNAKTLFAQNDVDGGLIGGASLKAEDFI
SICQAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaatcttagaaagccattcgtggctggcaactggaaaatgaatggaaatttg
gcattagttgctgaattcaatcaaaaattagcgaacgtaaaagctgaatcggaaatcgta
atttgcgctccttcacttcttttacacgcatttgaaacccagtcatttgccattggcgct
caaaacgtaagtcatctgaataacggcgctcacactggtgagttgtctgttgaaatgctt
aaagaggcgggttgtggttacgcaatcgtcgggcattctgaaagacgagaagaccaaggc
gagtcaagcaaacttgttgcattaaaggcgaaacagtgcgtttcctctggtgttgtacct
atcatttgtgtaggtgagccactagaagtaagagaagcaggcaacgtcgaggcatacgtt
ggtgaacaactagatgcgcttattgatgccatgtctgttgaagaacttagcaagactgtt
attgcatatgagccgatttgggcaataggtactggtaaaacagctagcccagaacaagca
caagaagtacacgaatttattcgcggctactttgcaaaagtagacgcacaattggctcaa
ggccttcgtattttatacggtggtagtgttaagccagacaatgctaaaaccctgtttgct
cagaacgatgtagatggtggtttaattggcggagccagtttaaaagctgaagattttatt
tcaatttgccaagcggcaaactga

DBGET integrated database retrieval system